SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for R8Y8R2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R8Y8R2
Domain Number 1 Region: 1-262
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.9e-67
Family Phosphate binding protein-like 0.0000739
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) R8Y8R2
Sequence length 265
Comment (tr|R8Y8R2|R8Y8R2_BACCE) Cystine-binding protein {ECO:0000313|EMBL:EOQ65659.1} KW=Complete proteome OX=718222 OS=Bacillus cereus TIAC219. GN=IAY_00121 OC=Bacillus cereus group.
Sequence
MKKLFSVLAVTTLAIGIVAGCGKEEKKDTASQDALQKIKQSGELVIGTEGTYPPFTFHDS
SNKLTGFDVELSEEVAKRLGVKPVFKETQWDSLLAGLDAKRFDMVANEVGIREDRQKKYD
FSKPYVSSSAALVIAKDKDKPATFADVKGLKGAQSLTSNYADIAKKNGAEIIGVEGFSQA
AELLASGRVDFTINDKLSVLNYLETKKDAKIKIVDTEKEASQSGFLFRKGSDKLVQEVDK
ALEDMKKDGTYDKITKKWFGENVSK
Download sequence
Identical sequences A0A0F6J315 A0A160GVX2 A0A1B1L170 A0A243AI86 J7WLF7 M1PG43 R8Y8R2 V5M540
gi|558679318|ref|YP_008817447.1| gi|384184909|ref|YP_005570805.1| gi|452197215|ref|YP_007477296.1| WP_000732858.1.11442 WP_000732858.1.17374 WP_000732858.1.23245 WP_000732858.1.23360 WP_000732858.1.3249 WP_000732858.1.33790 WP_000732858.1.34537 WP_000732858.1.41729 WP_000732858.1.57561 WP_000732858.1.5895 WP_000732858.1.59384 WP_000732858.1.62277 WP_000732858.1.71652 WP_000732858.1.80622 WP_000732858.1.84541 WP_000732858.1.84775 WP_000732858.1.8577 WP_000732858.1.91020 WP_000732858.1.9700 WP_000732858.1.97816 gi|410673200|ref|YP_006925571.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]