SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for S0GV49 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  S0GV49
Domain Number 1 Region: 509-965
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1.55e-33
Family alpha-mannosidase, C-terminal domain 0.012
Further Details:      
 
Domain Number 2 Region: 112-328
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 2.78e-21
Family alpha-mannosidase 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) S0GV49
Sequence length 965
Comment (tr|S0GV49|S0GV49_9BACT) Uncharacterized protein {ECO:0000313|EMBL:EOS19648.1} KW=Complete proteome; Reference proteome OX=1235789 OS=Parabacteroides goldsteinii dnLKV18. GN=C803_00327 OC=Parabacteroides.
Sequence
MKTLKTLFLAGLALFAMSSFAWSGSTAPPGIETHLFPALYKTAKGPVQKVRVTVKHEGAS
ANATITLGDQSRKVKLNDGPNPFFFEIPQIQSTVQLPLTVTVGKEQESARVEVKPVRHWQ
MNMVQHTHTDIGYTRSQTEILAEHLRYIDYALDYCDATDNYPDFAKFRWTCEIAWAVSEY
LKCRPAEQIARLKKRVAEGRIELAAMYLNFDELPDEQTLAASLYPLKAFREAGMKAEVAM
QNDVNGIGWCFTEFFADAGVKYVNMGTHGHRALICFDIPTVFWWQSPSGKKVLTYRAEHY
NQGNFFGIHTDNFEQFEERVLNYLGEMEAKNYPYDIVAAQHSGYFTDNSPPSTKSCEMLM
KWNEKYEWPKLRTAVASEFIKDVETNYADKIQTIRGAWPDWWTDGFASGAREAAISRITH
SDIIANQAGLSFAGMLGAKLPAQIGNQIDDINKALLFYDEHTFGYSESVRNAYCKETWEQ
RSLKQSYAWEAYRHSGLLGEVTMGLLQSFVPKAEYPSVAVFNTLNWTYSGIAKVYIDHQI
LPREKAFEIVDAFGNIIPAQPAESRSDGTYWSLYVKDVPAFGYAQYYIKVKDEPRPAVQL
ADKLENAHVENPWYAIDFNTRKGTISKLFDKELNKELTTPNAEWELGEFIYEIIDSRHPM
EQYRAPQFLRRRPERIRFERYEKGAIWDTYRFRGETVAGREPNNLMVEFRVFNVTKKIDI
VYRLRKKAITDPEAVYISFPFEVNQGKIFLDVPGGTIEAGVDQIPGSSNDWYTVQNFATA
RNSESQVVMGSPEIPLMQFGAINTGRYKAGAVPQSTNMYSWPMNNYWVTNFNADQMGELQ
WSYFINSSKDNSIGYATRFAWENRIPFLTRVLPAGAKGSKVVSPASVFNISSDNLLLVNM
KPVEGENAVMLQLREIAGKPAEFAVTSDKVNFTKVTVCDVVGDPIAGNATTDFVPWENKF
IKLSW
Download sequence
Identical sequences S0GV49
WP_010802782.1.45416 WP_010802782.1.51638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]