SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for S0J945 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  S0J945
Domain Number 1 Region: 4-264
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.48e-79
Family Protein kinases, catalytic subunit 0.00000155
Further Details:      
 
Domain Number 2 Region: 460-521
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000222
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.011
Further Details:      
 
Domain Number 3 Region: 527-588
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000235
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.01
Further Details:      
 
Weak hits

Sequence:  S0J945
Domain Number - Region: 392-454
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000343
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) S0J945
Sequence length 691
Comment (tr|S0J945|S0J945_9FIRM) Uncharacterized protein {ECO:0000313|EMBL:EOT24288.1} KW=Complete proteome; Reference proteome OX=1235790 OS=Eubacterium sp. 14-2. GN=C805_02500 OC=Eubacterium.
Sequence
MLKEGIYLGDRYEIVGKAGSGGMADVYKAKDHTLGRFVGIKVLKPEFSEDVNFVTKFRTE
AQSAAVLEHPNIVNIYDVGSENSVHYIVMEYVEGITLKTYIEKKGQISFKEAVSIAIQVG
RGIEAAHNKHIIHRDIKPQNIIISTEGKVKVTDFGIARVANTNTINSDVMGSVHYASPEQ
ARNGFVDGKSDIYSLGIVMYEMVTGRVPFDGESTVAVAIQHLQEEMVVPSAYAPSLPVSI
EKIILKCTQKSPDRRYNSISDLLMDLKKALISPDEDFVVMVPLGQQDKTRVMKPDEVESI
KEQTRSIYYQDEEEEEDEEEPEEEEDDEGFLNPKMEKAVTIMGIVAAVIIVMIIVYIGGS
FMGLFKFGDRKKEEEKKPVENETQQEEESEKVEMIDLKGYTYDEAMEELKKIQLGIEKGG
EESSEEYPEGQIVSQSEEQGAMVDKNTTIRVIISSGVGEFDVPDVKGKSKSEAESTLRSA
GLVPVFDYQFDDSIPNDQVISQNPDAGGKAKKGDTVTVMLSKGRETFQVPDVRNKPEAEA
REELKAAGIEVVSTSSDYADDIPEGNVISQSLTPGKTVEKGTQITLVISLGKKITTTYYS
LNNYSIELPNFIPDNASRVEARITLYKSEGEDVISSWKATSFPYTVNVSNIENCSQGYFV
IDWKWTYLDEDDAEITEEDQTTKDGIAFTQN
Download sequence
Identical sequences S0J945
WP_016215529.1.33326

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]