SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for S2YM27 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  S2YM27
Domain Number 1 Region: 9-268
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.7e-80
Family Protein kinases, catalytic subunit 0.00000242
Further Details:      
 
Domain Number 2 Region: 413-475
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00000157
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0089
Further Details:      
 
Domain Number 3 Region: 482-541
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000301
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.01
Further Details:      
 
Weak hits

Sequence:  S2YM27
Domain Number - Region: 621-680
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.017
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0097
Further Details:      
 
Domain Number - Region: 309-350
Classification Level Classification E-value
Superfamily ARM repeat 0.0547
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) S2YM27
Sequence length 723
Comment (tr|S2YM27|S2YM27_9FIRM) Uncharacterized protein {ECO:0000313|EMBL:EPD58567.1} KW=Complete proteome OX=1078090 OS=Coprococcus sp. HPP0074. GN=HMPREF1215_01586 OC=Coprococcus.
Sequence
MLNEGTMLNGRYEILGKIGAGGMADVYKGKDHKLNRFIAIKVLKKEFHEDDSFIQKFTSE
AQAAGGLMHPNVVNVYDVGEDQGANYMVMELVEGITLKQYIQKKGRLSAKEAISITIQMA
NGIQAAHNKNIIHRDIKPQNVIISKEGKVKVTDFGIAKAANSNTMSSTVLGSVHYTSPEQ
ARGAASDARSDIYSLGITMYEMVTGRLPFDGDTAVAVAVKHLQEEIVSPAEYVPELPYSL
EQIILKCTQKRPEFRYPDVASLVLDLKRSLVDPEGDFVRIRRVPGSDTVMLSEGELQKLQ
MNNISARRYDDYDDDDYDEEQYDDYDNDYDDDYDDDYDDEYDQDDDYDEDDYGRGTSRKR
NGDVNPRMNKLIKILMIVVAVLIAFFVIMMAGKAAGIFGSGLGFVTEDSKDKVKVPNVVG
KTQADAIEALNKVNLGYELVDGGESDKYEKGYVMEQGTKAGTKIAKNTRVKIVVSSGKKK
EEVTMPDVKGLNQDKAQKELEKLGLKVSVTYEYSSMYTEGEVISTTYEPGTKVAKGTEVG
MQVSKGEEPIEKVAVPEITGKTEVDAIAALEAVGLYAGDRKEEYSDEPAGTVISQDIAGG
NKIEVGGSVGYTVSKGKEKAKMPAVIGLSEADAKAQLQAAGLTPVIYHEPNENQKGSVFY
ASANTGDELEKGATVEIWISDGPAEQPPTDGNNNGNTDHNGSGDNNSGSTDGNTTGQEGN
SGH
Download sequence
Identical sequences S2YM27
WP_016439304.1.26124

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]