SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for S4R3S4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  S4R3S4
Domain Number 1 Region: 3-113
Classification Level Classification E-value
Superfamily ALDH-like 2.62e-36
Family ALDH-like 0.00000062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) S4R3S4
Sequence length 117
Comment (tr|S4R3S4|S4R3S4_HUMAN) Aldehyde dehydrogenase, mitochondrial {ECO:0000313|Ensembl:ENSP00000474669} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=ALDH2 OC=Catarrhini; Hominidae; Homo.
Sequence
XEQAHFALFFNQGQCCCAGSRTFVQEDIYDEFVERSVARAKSRVVGNPFDSKTEQGPQVD
ETQFKKILGYINTGKQEGAKLLCGGGIAADRGYFIQPTVFGDVQDGMTIAKEEGQLL
Download sequence
Identical sequences S4R3S4
ENSP00000474669 ENSP00000474669

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]