SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for S5C767 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  S5C767
Domain Number 1 Region: 153-297
Classification Level Classification E-value
Superfamily Thioesterase/thiol ester dehydrase-isomerase 1.01e-42
Family PaaI/YdiI-like 0.00016
Further Details:      
 
Domain Number 2 Region: 2-166
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 3.88e-25
Family N-acetyl transferase, NAT 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) S5C767
Sequence length 304
Comment (tr|S5C767|S5C767_9ALTE) GNAT family acetyltransferase {ECO:0000313|EMBL:AGP99159.1} KW=Complete proteome OX=1300258 OS=Alteromonas mediterranea UM7. GN=I635_18290 OC=Alteromonadaceae; Alteromonas.
Sequence
MYKVVTPKSDAEFEAYFHFRWEHLRQPWNFPPGSEKDEYEQVAEHRIITNRKGDIVACGR
VHLNTAEEAQIRHIAVHSDHQRKGLGQMIMAALENVAKDLGAERAVTNSREISIDFFSSC
GFEIEREAPNELGMLKRQQMVKKFTENNSLILHPKWCKSLQETWSETIPITEHMGIKLYQ
YTGRTLETRASLNKNINIHGTMFAGSIFSLATLTGWGMIYLQLKERGLDGDIVLGDGDIH
YHKPITMKPRAICNIETLSGKFKPLENDNKARFELSVAILDGDTPVAEFEGVFYVLPPSK
NEEE
Download sequence
Identical sequences A0A2E1R5P9 S5C767
gi|522591497|ref|YP_008177574.1| WP_015068277.1.21115 WP_015068277.1.24997 WP_015068277.1.30323 WP_015068277.1.34434 WP_015068277.1.36926 WP_015068277.1.50651 WP_015068277.1.68468 WP_015068277.1.96561 gi|522817223|ref|YP_008185452.1| gi|522669434|ref|YP_008197896.1| gi|522615871|ref|YP_008181561.1| gi|522571053|ref|YP_008173482.1| gi|410863265|ref|YP_006978499.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]