SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for S5NAD8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  S5NAD8
Domain Number 1 Region: 207-600
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 8.12e-83
Family beta-Lactamase/D-ala carboxypeptidase 0.0000023
Further Details:      
 
Domain Number 2 Region: 64-255
Classification Level Classification E-value
Superfamily Penicillin binding protein dimerisation domain 1.83e-42
Family Penicillin binding protein dimerisation domain 0.0000346
Further Details:      
 
Domain Number 3 Region: 603-658
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000000000000301
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0041
Further Details:      
 
Domain Number 4 Region: 661-714
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00000000000353
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) S5NAD8
Sequence length 719
Comment (tr|S5NAD8|S5NAD8_LACRE) Penicillin-binding protein 2B {ECO:0000313|EMBL:AGR64018.1} KW=Complete proteome OX=1358027 OS=Lactobacillus reuteri TD1. GN=N134_03250 OC=Lactobacillus.
Sequence
MNKKPQRTKNRGHRENRGTFGKWLFLITVGLFTLFIVRFAYIAINKDVQHVNLRSQAEQI
YTQQRIIQARRGDIYDSEGNPLATDTSKYTLYAVLDRTQKSSDGKPLYVKDRKKTAKVLS
QYIDLTPKQIEKILKPKGQAYQVEFGNAGSNLSVSIMQKIKNRHLPGINFIATPARQYPE
GEFASQIIGMATPKVKNDNGTEETNLVGQLGLEGYFNKQLTGINGLRKDKQDVYGYQIAN
SKQVTKKAINGDNIYTTLDSQTQHFLENKVNKVYKSSNANAMTAVVMEAKTGKIIAATQR
PTLHAENNPVWRNMLVQDAYEPGSVMKILSLAAAIDTGHFNPNATFNSGTWAMGGGKITD
WSSSGWGTISYKDAFDMSSNVGFAHVEQDMGAETWMKYIKRFGLLKKVNVIGMSNEVNGY
TSFKGILAQANTAFGQGITVNVMQMMQAFSAIGNNGKMMKPYIVSKVVDGNSGKTIQKVK
PKVVGHPIKASTAKKVLGYMQGVVYDQKGLGHDYQIKGYRIAGKTATAQIGGAHGYSTGD
TNYLYSFAGMAPAKNPKYIMYVTLRQPQNLKKPATKQIASVFNPTMKMLLSQQKVAEKAK
KKVITMPNVVGQASDEANKELSGKGMQVIIVGSGKKVKQQSAVPDEQVLTDQHVILDTGG
EYKMPDISGWSSADVQQLAKVLKLKVKENGNGYVTQQSISPDTTIKRGTTLTVQYEAKN
Download sequence
Identical sequences A0A244CHH7 S5NAD8
WP_019254294.1.3626 WP_019254294.1.56784 WP_019254294.1.70907 gi|526231234|ref|YP_008325959.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]