SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for S5Z6D5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  S5Z6D5
Domain Number 1 Region: 4-67
Classification Level Classification E-value
Superfamily Homeodomain-like 4.84e-18
Family Alr1493-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) S5Z6D5
Sequence length 68
Comment (tr|S5Z6D5|S5Z6D5_9CREN) Uncharacterized protein {ECO:0000313|EMBL:AGT34880.1} KW=Complete proteome; Reference proteome OX=1365176 OS=Thermofilum adornatus. GN=N186_02495 OC=Thermofilum.
Sequence
MRLEIGRYIVIDDEVCHGKPVFKGTRVLVSDVVELLGAGVSIEEIVRDYYPSLNEEMIRE
ALRYFASC
Download sequence
Identical sequences S5Z6D5
WP_020962184.1.19067 WP_020962184.1.66495 gi|530780085|ref|YP_008431890.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]