SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for S5ZLG0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  S5ZLG0
Domain Number - Region: 57-137
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0179
Family Tetracyclin repressor-like, N-terminal domain 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) S5ZLG0
Sequence length 143
Comment (tr|S5ZLG0|S5ZLG0_9CREN) Transcriptional regulator {ECO:0000313|EMBL:AGT35461.1} KW=Complete proteome; Reference proteome OX=1365176 OS=Thermofilum adornatus. GN=N186_05590 OC=Thermofilum.
Sequence
MEVPLKPLGKEDTRKLELALIFGTLMRQDVLEKIRNAEDKITWLDSLIIASGALARERAG
MPVTKIAEELGRTEATIRNHLTGKTEAGKIVKETYELLVKKGGKLEFLIPGGEEIEKLRR
ENEELKKKIENVKQALQSLLSTL
Download sequence
Identical sequences S5ZLG0
gi|530780666|ref|YP_008432474.1| WP_020962768.1.19067 WP_020962768.1.66495

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]