SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for S6D6D0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  S6D6D0
Domain Number 1 Region: 4-241
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.43e-23
Family Phosphate binding protein-like 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) S6D6D0
Sequence length 249
Comment (tr|S6D6D0|S6D6D0_ACEPA) Uncharacterized protein {ECO:0000313|EMBL:CCT60733.1} KW=Complete proteome OX=1266844 OS=Acetobacter pasteurianus 386B. GN=APA386B_2700 OC=Acetobacteraceae; Acetobacter.
Sequence
MTSLTLAYPETTVHEATAAAIIRVLEANDVEPDIVTGPKDVLTDMLKKGEVDFYVSAWLP
DEDAGMLAPGILPLGNLFRPAAHCCISAEDTPLTSLDDVAQAGPELSRTIITPASLRKHM
ENVLQQYGLDTAGFSLKVLPDEEALAELNAALKREELVLMPLFQPCFLFHIGGFRILNDP
KNALGGEQDARILIRAETKDEMEQDLLDELDELMLSAKIISAMDYAMRVEGMTADEAAEA
WQRGKLLPR
Download sequence
Identical sequences C7JH72 S6D6D0
gi|384062986|ref|YP_005483628.1| gi|384119062|ref|YP_005501686.1| gi|258542273|ref|YP_003187706.1| gi|529232637|ref|YP_008393452.1| gi|384042194|ref|YP_005480938.1| gi|384053819|ref|YP_005486913.1| gi|384057053|ref|YP_005489720.1| 634452.APA01_11790 gi|384059694|ref|YP_005498822.1| gi|384050711|ref|YP_005477774.1| WP_004449115.1.36695 WP_004449115.1.37930 WP_004449115.1.38618 WP_004449115.1.45580 WP_004449115.1.55019 WP_004449115.1.62313 WP_004449115.1.64431 WP_004449115.1.65311 WP_004449115.1.71918 WP_004449115.1.88241 WP_004449115.1.96488 WP_004449115.1.99323

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]