SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for S7MQJ1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  S7MQJ1
Domain Number 1 Region: 614-869
Classification Level Classification E-value
Superfamily YWTD domain 3.66e-56
Family YWTD domain 0.00000581
Further Details:      
 
Domain Number 2 Region: 3-263
Classification Level Classification E-value
Superfamily YWTD domain 2.49e-55
Family YWTD domain 0.00000166
Further Details:      
 
Domain Number 3 Region: 313-543
Classification Level Classification E-value
Superfamily YWTD domain 3.14e-51
Family YWTD domain 0.00000321
Further Details:      
 
Domain Number 4 Region: 916-1177
Classification Level Classification E-value
Superfamily YWTD domain 1.29e-38
Family YWTD domain 0.0000623
Further Details:      
 
Domain Number 5 Region: 1313-1351
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000249
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 6 Region: 1234-1274
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000223
Family LDL receptor-like module 0.00084
Further Details:      
 
Domain Number 7 Region: 1275-1310
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000982
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 8 Region: 569-615
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000198
Family EGF-type module 0.0091
Further Details:      
 
Domain Number 9 Region: 872-919
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000199
Family EGF-type module 0.016
Further Details:      
 
Domain Number 10 Region: 267-310
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000073
Family EGF-type module 0.011
Further Details:      
 
Domain Number 11 Region: 1185-1219
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000404
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) S7MQJ1
Sequence length 1593
Comment (tr|S7MQJ1|S7MQJ1_MYOBR) Low-density lipoprotein receptor-related protein 5 {ECO:0000313|EMBL:EPQ06619.1} KW=Complete proteome; Reference proteome OX=109478 OS=Myotis brandtii (Brandt's bat). GN=D623_10030839 OC=Vespertilionidae; Myotis.
Sequence
ASPLLLFANRRDVRLVDAGGVKLESTVVVSGLEDAAAVDFQFSKGTVYWTDVSEEAIKQT
YLNQTGAAVQNVVISGLVSPDGLACDWVGKKLYWTDSETNRIEVANLNGTSRKVLFWQDL
DQPRAIALDPAHGYMYWTDWGETPRIERAGMDGSTRKVIVDSDIYWPNGLTIDLEEQKLY
WADAKLSFIHRANLDGSFRQKVVEGSLTHPFALTLSGDTLYWTDWQTRSIHACNKRTGEK
RKEILRALYSPMDIQVLSPERQPFHTQCEEDNGGCSHLCLLSPREPFYTCACPTGVQLQD
NGKTCKAGAEEVLLLARRTDLRRISLDTPDFTDIVLQVDDIRHAIAIDYDPLEGYVYWTD
DEVRAIRRAYLDGSGAQTLVNTEINDPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTSRK
ILVSEDLDEPRAIALHPMMGLMYWTDWGENPKIECANLDGQERRVLVNTSLGWPNGLALD
LQEGKLYWGDAKTDKIEVINVDGTKRRMLLEDKLPHIFGFTLLGDFIYWTDWQRRSIERV
HKVKASRDVIIDQLPDLMGLKAVNVAKVVGTNPCADQNGGCSHLCFFTPRATKCGCPIGL
ELLSDMKTCIVPEAFLVFTSRATIHRISLETNNNDVAIPLTGVKEASALDFDVSNNHIYW
TDVSLKTISRAFLNGSSVEHVIEFGLDYPEGMAVDWMGKNLYWADTGTNRIEVARLDGQF
RQVLVWRDLDNPRSLALDPTKGYIYWTEWGGKPRIVRAFMDGTNCMTLVDKVGRANDLTI
DYADQRLYWTDLDTNMIESSNMLGQERIVIADDLPHPFGLTQYSDYIYWTDWNLHSIERA
DKTSGRNRTLIQGHLDFVMDILVFHSSRQDGLNDCVPGNGQCGQLCLAVPGGHRCSCASH
YTLDPSSRNCSPPSTFLLFSQKNAISRMIPDDQHSPDLILPLHGLRNVKAIDYDPLDKFI
YWVDGRQNIKRARDDGTQASPFILTTPSPNQSPDRQPHDLSIDVYSRTLFWTCEATNTIN
VHRLDGDAMGVVLRGDRDKPRAIVVNAERGYLYFTNMQDRTAKIERAALDGTEREVLFTT
GLIRPVALVVDNTLGKLFWVDADLKRIESCDLSGANRLTLEDANIVQPVGLTVLGRHLYW
IDRQQQMIERVEKTTGDKRTRVQGRVAHLTGIHAVEDISLEEFSAHPCARDNGGCSHICI
AKGDGTPRCSCPVGDQLHWVGLRVTVLLSPPPEPPTCSPDQFTCATGDIDCIPAAWRCDG
FPECDDQSDEEGCPVCSDAQFPCARGQCVDLRLRCDGEADCQDRSDEADCDALCLPNQFR
CASGQCILIKQQCDSFPDCIDGSDELMCEITKPPLDEGPAHSSAIGPVIGIILSLFVMGG
VYFVCQRVVCQRYTGANGPFPHEYVSGTPHVPLNFIAPGASQHGPFTGISCGKSMMSSVS
LMGGRGGVPLYDRNHVTGASSSSSSSTKATLYPPILNPPPSPATDPSLYNVDVFYSSNIP
APARPYRPYIIRGIAPPTTPCSTDVCDSDYSASRWKASKYYLDLNSDSDPYPPPPTPHSQ
YLSAEDSCPPSPATERSYFHLFPPPPSPCTDSS
Download sequence
Identical sequences S7MQJ1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]