SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for S7MWZ1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  S7MWZ1
Domain Number 1 Region: 1032-1161,1226-1292
Classification Level Classification E-value
Superfamily Hemopexin-like domain 3.21e-40
Family Hemopexin-like domain 0.00077
Further Details:      
 
Domain Number 2 Region: 69-107
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000000641
Family Somatomedin B domain 0.0011
Further Details:      
 
Domain Number 3 Region: 27-66
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000131
Family Somatomedin B domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) S7MWZ1
Sequence length 1292
Comment (tr|S7MWZ1|S7MWZ1_MYOBR) Proteoglycan 4 {ECO:0000313|EMBL:EPQ09146.1} KW=Complete proteome; Reference proteome OX=109478 OS=Myotis brandtii (Brandt's bat). GN=D623_10007712 OC=Vespertilionidae; Myotis.
Sequence
MEWKILPIHLLLLLSVFLIQQVSSQDVSSCAGRCGEGYSRDTPCNCDYNCQLYMECCPDF
KKFCTVELSCKGRCSESFERGRECDCDNQCKKYGKCCPDYDDFCEVHSPTSPPSSKAAPP
PAGARQPIKSTTKRSPKPTDKKTTKKVIESEEITEEHSVSENQESSSSSSSSSSSIRKIK
SSKNSAANKELKKKPKVKDNKKENPKKKPAPEPPVVDEAGSGLDEGDSKPTPTPDTPTTQ
STKVTTTSKVTTVTTVSPKPSPSPKPETSKDTSSTASKEKTVETKETSKTTKETSASTSE
KTTSAPTSPETPPTTSEASTPATTMEPPTPPENPAGSTPEFPVDPTPKAPEGTKSETTTT
LKDKTTEKGTHTTTEITTATSTSTTKETATPKEDKTTESQTSTTKQVTSTTTKDTTSAKV
TPKETTPAPEVTPTEDKTTESQTIKDNKKENPKKKPAPEPPVVDEAGSGLDEGDSKPTPT
PDTPTTQSTKVTTTSKVTTVTTVSPKPSPSPKPETSKDTSSTASKEKTVETKETSKTTKE
TSASTSEKTTSGKETRSAEKTSKDLEATSVSVKTTTEAETTTTSLTPTTPQTPSPTTTTK
EPTTTPKKPEPTTPKKPEPTTPKKPAPTSPETPPTTSEASTPATTMEPPTPPENPAGSTP
EFPVDPTPKAPEGTKSETTTTLKDKTTEKGTHTTTEITTATSTSTTKETATPKEDKTTES
QTSTTKQVTSTTTKDTTSAKVTPKETTPAPEVTPTEDKTTESQTSTTKQVTSTTTKDTTS
AKVTPKETTPAPEVTPTEDKTTESQTSTTKQVTSTTTKDTTSAKVTPKETTPAPEVTPTE
DKTTESQTSTTKQVTSTTTKDTTSAKVTPKETTPAPEVTAATKKTTTTEETTNTSEDTVT
TSKVTTAKSPKPTKAPQMPTTTKKPNTTPKVTKPKPTPSPPKTTTSTVPTMNPASSEEDL
LQTTTSSNQASNSEMAEEHPKNEDANDAEGEKPYVILRPPVITPLIIPGADFTVRGSDQG
IGVNPMLSDETNLCNGRSVDGLTTLANGTLVAFRGHYFWMLNPLSPPSPPRRITEVWGIP
SPIDTVFTRCNCDGKTFFFKGSQYWRFTNDVKDPGYPKQIVKGFGGLNGKILAALSIPKY
KERPESVYFFKRGGRVQKYTYKQESNRQCPGRRPALNYPVYGGTTQVRRLRFERAIGSQT
HTISIQYSRPVRVLYQDKGFLHNEAQISTLWRGLPNLVTSAISLPNTRKPDGYDYYAFSR
DQAYNLNVPSRTARAVTTPSGKTLSNVWYNCP
Download sequence
Identical sequences S7MWZ1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]