SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for T0I785 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  T0I785
Domain Number 1 Region: 57-147
Classification Level Classification E-value
Superfamily Ribosomal protein L9 C-domain 1.16e-26
Family Ribosomal protein L9 C-domain 0.00018
Further Details:      
 
Domain Number 2 Region: 1-57
Classification Level Classification E-value
Superfamily L9 N-domain-like 3.66e-18
Family Ribosomal protein L9 N-domain 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) T0I785
Sequence length 148
Comment (tr|T0I785|T0I785_9FIRM) 50S ribosomal protein L9 {ECO:0000256|HAMAP-Rule:MF_00503} KW=Complete proteome OX=1339256 OS=Dehalobacter sp. UNSWDHB. GN=UNSWDHB_1110 OC=Dehalobacter.
Sequence
MKVILKEDVKALGKKGKVCEVSDGYARNFLIPRGLAVEATQGNVQDLVHKQKQEELRKQK
EKQAALDLSQKIENMDIIVKVKVGEKGRLFGSVTNKEIAEVLEKEYQLKLDKRKIEVKEP
IKGLGEYQVTVKLHFEVTANLKIKIEAQ
Download sequence
Identical sequences K4L618 T0I785
gi|410659599|ref|YP_006911970.1| gi|410662579|ref|YP_006914950.1| WP_015044993.1.6016 WP_015044993.1.71633 WP_015044993.1.88763

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]