SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for T0JK50 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  T0JK50
Domain Number 1 Region: 46-432
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 7.76e-48
Family Phosphate binding protein-like 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) T0JK50
Sequence length 439
Comment (tr|T0JK50|T0JK50_9FIRM) Uncharacterized protein {ECO:0000313|EMBL:EQB22763.1} KW=Complete proteome OX=1339256 OS=Dehalobacter sp. UNSWDHB. GN=UNSWDHB_2945 OC=Dehalobacter.
Sequence
MKSWTVKNTMLLLLLMMMLFSGCVPNDYLKGMAEDMNKEPLVMRITWKTYSGRGEAIQKI
VETYNAMGENHLKVQLADGDEDLAVIETLLNKNSNVDIFVLPYRYIKYFGNHGQLLDLTS
EFQAEKDYFYPNLWGLGVINQKTYGIPWLGHSICLLYNKTLLQKAGVDPETIKSVNDLAT
ACAKVEEGTEAKGIGLVGANHNDISWMVNQFIYGFGSSLVDSNGTTVTINNGKSIAAIDF
YKNTLGKYAQDTWKEDSGVEVMDYFREQQVAFEFQGVWGVTDIWKNGNPFKVGVIRLDDI
GLLPEVGPMMLALPSNLSPDRKEEAICFIRYLISKEAQENILKGEYSPEHEAYYPFRIPV
RNDLQDSDFFQLYPEFLSFSEGFKSPSIDVPVPQWQKIKDQYYAPGLHRVMKGELATEEL
LQTMEIEGNKILSEQENRR
Download sequence
Identical sequences K4L0D8 T0JK50
WP_015042756.1.6016 WP_015042756.1.71633 WP_015042756.1.88763 gi|410657328|ref|YP_006909699.1| gi|410660366|ref|YP_006912737.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]