SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for T0NJT6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  T0NJT6
Domain Number 1 Region: 6-150
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1e-20
Family Nucleotide and nucleoside kinases 0.051
Further Details:      
 
Domain Number 2 Region: 5-35,147-268
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000012
Family Extended AAA-ATPase domain 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) T0NJT6
Sequence length 315
Comment (tr|T0NJT6|T0NJT6_9BACI) Isopentenyl-diphosphate:tRNA isopentenyltransferase {ECO:0000256|HAMAP-Rule:MF_00185} KW=Complete proteome OX=1095383 OS=Geobacillus sp. A8. GN=GA8_12925 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Geobacillus.
Sequence
MAEKVAVIVGPTAVGKTKLGIALAKKLGGEVISGDSMQIYKGMDIGTAKVKPDEMEGIPH
HLLDIKEPCEPFSVVEFQRLCRALITEISARGRLPIIVGGTGLYIQAALYDYQFSAAPSD
EAYRRALKQLAAEQGAEALHRRLEAVDPISAARIHPHNIRRVIRALEVYHCTGKPFSEWQ
QGQSKRLLYEAAIVGLTAEREALYRRINERVDEMIAAGLIEEARALYDRGLRDCQAVQAI
GYKELYDYFDGRVSLDEAIEQLKQNSRRYAKRQLTWFRNQMPVKWFDMTDAGQFAAKVEE
ISRYVAGKLQLEANI
Download sequence
Identical sequences A0A063YX39 A0A098L3K4 A0A1D7NAD9 A0A1Q5SVM5 A0A1V4PA06 A0A1V9BYQ5 G8N2H6 Q5L0D9 S4NDZ8 T0NJT6 V6VAL8
gi|375008290|ref|YP_004981923.1| 235909.GK1312 WP_011230811.1.100150 WP_011230811.1.19233 WP_011230811.1.2219 WP_011230811.1.25743 WP_011230811.1.3446 WP_011230811.1.45808 WP_011230811.1.6497 WP_011230811.1.70239 WP_011230811.1.77642 WP_011230811.1.78869 WP_011230811.1.8599 WP_011230811.1.90668 WP_011230811.1.91533 WP_011230811.1.93593 gi|56419847|ref|YP_147165.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]