SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for T0QCZ2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  T0QCZ2
Domain Number 1 Region: 503-1082
Classification Level Classification E-value
Superfamily Cobalamin (vitamin B12)-dependent enzymes 3.92e-154
Family Methylmalonyl-CoA mutase, N-terminal (CoA-binding) domain 0.000000436
Further Details:      
 
Domain Number 2 Region: 147-464
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.52e-60
Family Nitrogenase iron protein-like 0.00024
Further Details:      
 
Domain Number 3 Region: 4-143
Classification Level Classification E-value
Superfamily Cobalamin (vitamin B12)-binding domain 1.03e-42
Family Cobalamin (vitamin B12)-binding domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) T0QCZ2
Sequence length 1086
Comment (tr|T0QCZ2|T0QCZ2_9BACI) Isobutyryl-CoA mutase {ECO:0000256|HAMAP-Rule:MF_02050} KW=Complete proteome OX=1095383 OS=Geobacillus sp. A8. GN=GA8_00710 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Geobacillus.
Sequence
MAHIYRPKHHVRFVTASSLFDGHDASINIMRRILQASGAEVIHLGHNRSVEEIVNAAIQE
DVQGIAVSSYQGGHMEFFKYMYDLLQERGASHIRIYGGGGGVIIPREIKELHEYGIARIF
SPEDGRRLGLQGMINVMLEECDFPTVTVVTDELERLPSGDVQAIARLITLCEYRAEGENK
EAAAAAEAAIEQVKALEKRVPVLGITGTGGAGKSSLTDELVRRFLNEIPDIKIAILSVDP
TKQKTGGALLGDRIRMNSINSPRVYMRSLATRHSRTELSPAIRDAISVVKAAGFDLVIIE
TSGIGQGDAAITEVCDVSMYVMTSEFGAPTQLEKIDMIDYADLIVINKFERKGSEDAKRQ
VQKQYQRSHQLFDRDVSEMPVYGTIASQFNDPGTNTLFVALVDTINKKAGTNWKTSLKTV
ANVEKHNVIIPNERRYYLREIAETVRSYHRRAEQQVEVARRLFQIEGAIEAAKERGEAED
VIRALETLKADYEAKLTPESKRILATWEETKAKYAAKQFVTKVRDKEIVTELTTKTLSGL
DIPKVVLPKFKDYGEILRWVYKENVPGSFPYTAGVFPFKRQGEDPKRQFAGEGTPERTNR
RFHYLCKEDKAKRLSTAFDSVTLYGEDPDYRPDIFGKVGESGVSVCTLDDMKKLYKGFDL
CDPLTSVSMTINGPAPILLAMFMNTAIDQQVEKKEAELGRPLTPEEYEQVKEWTLQTVRG
TVQADILKEDQGQNTCIFSTDFALKMMGDIQEYFIKHRVRNYYSVSISGYHIAEAGANPI
TQLAFTLANGFTYVEYYLSRGMHIDDFAPNLSFFFSNGLDPEYSVIGRVARRIWAIVMRE
KYGANERSQKLKYHIQTSGRSLHAQEIDFNDIRTTLQALLAIYDNCNSLHTNAYDEAITT
PTEESVRRAMAIQLIITKEFGLTKNENPLQGSFIIEELTDLVEEAVLQEFERLNDRGGVL
GAMEMQYQRGKIQDESLYYETKKHTGELPIIGVNTFLNPNPPSEDELNNIQLARATYEEK
ETQIRNLREFQERNKDKAGPALERLKQVATSGGNIFEELMETVKVASLGQITRALYEVGG
QYRRNM
Download sequence
Identical sequences A0A063YXW8 A0A1D7NFR1 A0A1V9BY78 A0A2H5KIM4 L8A3W6 Q5KUG0 T0QCZ2 V6VNA1
gi|448239670|ref|YP_007403728.1| WP_011232858.1.100150 WP_011232858.1.17728 WP_011232858.1.19233 WP_011232858.1.2219 WP_011232858.1.25743 WP_011232858.1.45808 WP_011232858.1.6497 WP_011232858.1.70239 gi|56421926|ref|YP_149244.1| 235909.GK3391

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]