SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for T1E714 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  T1E714
Domain Number 1 Region: 2-268
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 4.45e-98
Family Capz beta-1 subunit 0.000000000435
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) T1E714
Sequence length 272
Comment (tr|T1E714|T1E714_CROHD) Capping protein beta subunit {ECO:0000313|EMBL:JAA97522.1} OX=35024 OS=Crotalus horridus (Timber rattlesnake). GN= OC=Toxicofera; Serpentes; Colubroidea; Viperidae; Crotalinae; Crotalus.
Sequence
MSEQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYL
LCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVY
LWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTN
KTGSGTMNLGGSLTRQMEKDETVSDSSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIV
NGLRSVQTFADKSKQEALKNDLVEALKRKQQS
Download sequence
Identical sequences A0A1W7RIP2 J3S844 T1E714 U3FDJ8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]