SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for T1HM15 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  T1HM15
Domain Number 1 Region: 632-756
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 4.45e-39
Family Regulator of G-protein signaling, RGS 0.0000772
Further Details:      
 
Domain Number 2 Region: 7-92
Classification Level Classification E-value
Superfamily PDZ domain-like 6.84e-20
Family PDZ domain 0.0091
Further Details:      
 
Domain Number 3 Region: 939-1006
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000000482
Family Ras-binding domain, RBD 0.0062
Further Details:      
 
Domain Number 4 Region: 206-314
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000063
Family Phosphotyrosine-binding domain (PTB) 0.0096
Further Details:      
 
Domain Number 5 Region: 884-951
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000594
Family Ras-binding domain, RBD 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) T1HM15
Sequence length 1179
Comment (tr|T1HM15|T1HM15_RHOPR) Uncharacterized protein {ECO:0000313|EnsemblMetazoa:RPRC005089-PA} KW=Complete proteome; Reference proteome OX=13249 OS=Rhodnius prolixus (Triatomid bug). GN= OC=Panheteroptera; Cimicomorpha; Reduviidae; Triatominae; Rhodnius.
Sequence
MHPVRRRKKRPNYGVRTVEVKRGQNGFGFTISGQHPCILSCIVPGSPAETSGLRAGDYLV
AVEGQSVSKVPHDDVVRLIGCSNGVLKLQIAESYYSDSSDDDVIIASRQKPKYTHKTTFT
RIHSYQSNRSLIKVVRDLRTGAMFEEDECVLTPPRSSKPDWKDVSPLVRPLLISCLPESG
LPADYSHNYHSSLTREPDNHEILTAVVGYVGTIEMPTKLPPQSSLQVVRGCIKRLRAEKR
THTPVLMTVLSRSLRLASGNGATLAVYPKERVTFCARAQDKDDRHFGVVTTGSGHADPSS
SCHVFALDPKHHTNLTNRARLFSIDCQGEHSSAATKEVPLTSEPIVTLIKSLYEGDGGSG
SSGAVSMAVNRAGVANSPQPSHDSTTTTSNSDSGIGFRDDSGNQSDRILMVEPNNRPQLH
LHHVCLATSYCKEYSLFMTFLLAVSTDLFKTEYMFKLFRCPVGSLEDKVNFREMNASCRS
RSPLSTGSEGPAFLEEMSVSSAATKSPTEDLASPYKLSPKVWFLIKVRHRVSMQSSSMVY
SSLYREPKYSSSPETYPNQFSRKKSTYRVVKLIYIRKKINSRKNRGELQKSSYRKRPMPG
THWGSLQDLRVLSTDCESPVHTLVKMANTDKGAVSSWATSFEKLLDDTIGLQTFAEFLKK
EFSHENIFFWVSCENYRRMEDVEERKKKAKEIFECHLDLGALEPVNVDSYARQITEEQLD
SAPPDLFLQAQKQIFNLMKFDSYPRFIKSELYKECVVRVLAGEEIPVKSSSSQLQLNSSV
PHTKVGYPCMESSVPTRFCQGSKARDGERASFNNTDILLTLFKLIKSWSDAEERCRKSLL
GWAVRRGWAKSRDRADNYSDEGGNSVSSSISSLSTWDVALSSGLTRVGLPDGSTAVVPAR
PGLTVRDLISNLLSKRAIDMPDFNVRFNYRNKVICLDDDASSLSGQEVTVERKVVFRLDL
PNRKTILVKSRGCNSLSHVLRPILIKYGYSIDMVTLCLVSMKRIMSVKDLDLFGPIGTLT
EVRDQQRERHRNRAKYINFFTKSLDEITNRVFEELLQGKVGSSNPVLSDQGSVRSEDWGS
ESSSGILDRFLRCDSAFIDKQRVSIKSNTFKNQIKSEEGERKSTLSKLPPLIAKLKPSSK
YESRSESDVLYEGLKRAQRSRLEDQRGTEINFELPDFLK
Download sequence
Identical sequences T1HM15
RPRC005089-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]