SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for T1N0N7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  T1N0N7
Domain Number 1 Region: 152-229
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.05e-34
Family Ubiquitin-related 0.000028
Further Details:      
 
Domain Number 2 Region: 77-153
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.49e-34
Family Ubiquitin-related 0.000028
Further Details:      
 
Domain Number 3 Region: 230-305
Classification Level Classification E-value
Superfamily Ubiquitin-like 7.52e-34
Family Ubiquitin-related 0.000028
Further Details:      
 
Domain Number 4 Region: 2-77
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.33e-34
Family Ubiquitin-related 0.000028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) T1N0N7
Sequence length 306
Comment (tr|T1N0N7|T1N0N7_TRIUA) Uncharacterized protein {ECO:0000313|EnsemblPlants:TRIUR3_23898-P1} KW=Complete proteome; Reference proteome OX=4572 OS=Triticum urartu (Red wild einkorn) (Crithodium urartu). GN= OC=Pooideae; Triticodae; Triticeae; Triticinae; Triticum.
Sequence
QMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL
RLRGGQ
Download sequence
Identical sequences T1N0N7
TRIUR3_23898-P1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]