SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for T5HDN7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  T5HDN7
Domain Number 1 Region: 10-126
Classification Level Classification E-value
Superfamily YjgF-like 3.93e-34
Family YjgF/L-PSP 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) T5HDN7
Sequence length 129
Comment (tr|T5HDN7|T5HDN7_BACLI) Endoribonuclease L-PSP {ECO:0000313|EMBL:EQM26905.1} KW=Complete proteome OX=1368424 OS=Bacillus licheniformis CG-B52. GN=N399_15375 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MKPVHTKYSTRDGGHYVPAMEHNDVLYISGQLSMNPETGKIPAGGIKEEAKQALANMELV
LKERGLAKEDVILCRLYTPDVKYWPDINEVYAHFFGNHKPARVVVPSNHLYAGCLVEVEA
IAAIKEEAQ
Download sequence
Identical sequences A0A2A5Z5H3 Q65H17 T5HDN7
WP_011198139.1.12567 WP_011198139.1.1290 WP_011198139.1.30581 WP_011198139.1.31090 WP_011198139.1.34956 WP_011198139.1.35726 WP_011198139.1.35764 WP_011198139.1.55910 WP_011198139.1.70162 WP_011198139.1.7403 WP_011198139.1.74244 WP_011198139.1.86759 WP_011198139.1.94809 WP_011198139.1.98374 279010.BL02068 gi|52081133|ref|YP_079924.1| gi|404490012|ref|YP_006714118.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]