SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for U1K877 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  U1K877
Domain Number 1 Region: 122-440
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 3.31e-60
Family Pancreatic carboxypeptidases 0.018
Further Details:      
 
Domain Number 2 Region: 662-742
Classification Level Classification E-value
Superfamily PKD domain 0.0000000000576
Family PKD domain 0.013
Further Details:      
 
Domain Number 3 Region: 540-653
Classification Level Classification E-value
Superfamily PKD domain 0.000000044
Family PKD domain 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) U1K877
Sequence length 745
Comment (tr|U1K877|U1K877_9GAMM) Peptidase M14 carboxypeptidase A {ECO:0000313|EMBL:ERG43099.1} KW=Complete proteome OX=1117318 OS=Pseudoalteromonas rubra DSM 6842. GN=PRUB_21143 OC=Pseudoalteromonadaceae; Pseudoalteromonas.
Sequence
MKKNLLGMLLLSTISVTATAHSDPHVAHVQALSADNHTLSTYQLAFSSETQKAEYLSRFH
TAILEVANNYLVLSLTQQEFAELHSAGALIFSKPGESNQSEAAVQGDISAISRAQSTVPE
SGIPNFSCYPTLAETQQMAQTLAQTYPDFVELKHIGPSWEKSQGLGGHDLTVLVLKNKKK
NKWRKRPALYMQGALHAREYTPGATTLKFAQYLLENRETDADVNWILNQREIHILLIANP
DGRVLAEQGQFWRKNTNTAYCALDETLRGVDLNRNFDFAWASPIGGSTDDQCAATFHGPS
PASEPETQAIQAYLHDLFKDRRGDLLTDPAPLNTQGVFLDLHSFSRFVMWPWSSELTPSP
NADQLSMMGHRMAAYNGYWAFQTQEIFKAGGSADGYAYGQLGVASFTFELGNEFFESCAN
FEGEIFPNNLNALIYAAKVAKRPYKLPAGPQFFDLRLKGAGKEAVPAGTPVEIIATVADD
LFGPSLTGQVPPSQAISKVELTIKKKGKRGRKRILLPAADGAFDTVSESLNYTLDTHRWR
KGRYTLTLRAQDASGQWGPKYAKFLTIDNEAMPGTQSPVADFIADCRKGICGFDGSATQD
DRDSLTYTWVLQGGQFFRVFHGEQVEIEYTLAGDYQLTLQVDDSHGNRDVKVVQLELDGV
TPPVVQFDYQCTGLTCEFNSSASYDPDGEIVERLWRMGNEPYIPGVETVVHTFAAPGEYI
VVFVAIDNDGQFSQVAQTIQVTSNE
Download sequence
Identical sequences U1K877
WP_010380485.1.82046

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]