SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for U1MWM0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  U1MWM0
Domain Number 1 Region: 1001-1166
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.88e-55
Family DNA gyrase/MutL, second domain 0.0000245
Further Details:      
 
Domain Number 2 Region: 117-237,554-598
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 1.49e-25
Family Intein (protein splicing domain) 0.009
Further Details:      
 
Domain Number 3 Region: 27-110
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.57e-18
Family DNA gyrase/MutL, N-terminal domain 0.0038
Further Details:      
 
Domain Number 4 Region: 596-707
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 0.00000171
Family DNA gyrase/MutL, N-terminal domain 0.0067
Further Details:      
 
Weak hits

Sequence:  U1MWM0
Domain Number - Region: 729-775
Classification Level Classification E-value
Superfamily S13-like H2TH domain 0.073
Family Topoisomerase VI-B subunit middle domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) U1MWM0
Sequence length 1295
Comment (tr|U1MWM0|U1MWM0_9EURY) Type II DNA topoisomerase VI subunit B {ECO:0000256|HAMAP-Rule:MF_00322} KW=Complete proteome OX=1238425 OS=Haloquadratum walsbyi J07HQW2. GN=J07HQW2_01286 OC=Haloquadratum.
Sequence
MTSFQSELGEESEIADELAESQRAISIAEFFEKNKHMLGFDSGARGLVTAVKEAVDNALD
ATEEAGIKPDISIEIRESGDYYTLIVEDNGPGITREQVPKVFGKLLYGSRFHAREQSLTP
NQTLLVRRDGDVTFTSISELCDSHLLEDGPASAPIPADSNIEVPSFNRTTHEMTWQPVTN
AIRHRTDEDVYRVSTACGRTVEITGNHSLFSLSSSGETIEVNASELSPGDNILAPKQLPV
TPESTDVREAVDTEPQAGEKGQIINILDYIQLADLQESEYTFQIHGVDEASHSSVGDHHT
SSCAAKMSSSSSMMASTGVASSSGQQAHFSADRQHSKTDIFDSSHKNNESRISVKEIIEC
NEASTVADHTLEIINPDGETARLPVSVPIDDIVTSHLTKYITSESTPAVSHTSNSKLDNS
TPDEFSEGTTTPLESIISLICESAGEIRLPSFIFECDSEHQQQLLTKLYQHSETPNKTAA
SNDVATYTTSSETFARQLTTLWNMNGVVATTDTRTETIAAESERTVYEVSVDQAEVEVVT
DNEPDYQQHNGDLCLLSVNNIEQIDAPPYVYDISVPGASGHDENFVVTNDGAICVKNSRG
QQGIGISAAVLYSQLTSGKPARITTRTQSSDTAQYFELIIDTDTNEPEVSADRERDPGAA
SLSPTHGTRIELEMEANMRARGQLRDYVKDTAVVNPHARITLDEPGLEEPRQYERVDGAE
LPAQTEEIRPHPHGVELGTLLKMLEATESYSVSGFLREEFTRVGSKTATKILNRFRDRHF
GRALPVSAPETIPSDVADVDDTDDTLPSSLESIIEVAVVNKGASATAEFADRVAKTLNQR
SGTTRAELVKIVDTVAEDIEDEFETTFGTTVRENAVDAAWDVLTVDIDDDIYPLVADATS
TQKNHATVRGVADRVAAKFADDSTSLRATQDTVREYVDRSADMIVSEEVSFGETARENVV
NAVWKAMQTVEDELPAVKTIADDRNIASELLDAMRSTDILAPPTDCLSPITSTLVEAGLR
KEFDADFYAAATRDAEVHGGDPFVVEAGIAYGGELNDGNISLLRFANRVPLVYQRGACAT
TDVIKSIGWRNYGLDQPGGSGMPRGPAVVMIHVASTNVPFTSESKDALANIPAIEDEIEL
AVREASRDLKSYLNKRRSMQKRRKKQDVLGRILPEMANKLADVTENDRPEIDNALARIMN
NVNIERDVDNGSVTLTVQNYSDSQKSPTLTDIVDTKPDTIPDEIELVELEDEYFVTWEPV
VGAGESVTVTYEVPAEASFELDVDGVESEKLTIDA
Download sequence
Identical sequences U1MWM0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]