SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for U1PK22 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  U1PK22
Domain Number 1 Region: 1036-1201
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.37e-55
Family DNA gyrase/MutL, second domain 0.0000182
Further Details:      
 
Domain Number 2 Region: 117-237,579-623
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 2.94e-26
Family Intein (protein splicing domain) 0.012
Further Details:      
 
Domain Number 3 Region: 27-134
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 6.42e-19
Family DNA gyrase/MutL, N-terminal domain 0.0038
Further Details:      
 
Domain Number 4 Region: 621-732
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 0.0000037
Family DNA gyrase/MutL, N-terminal domain 0.0057
Further Details:      
 
Weak hits

Sequence:  U1PK22
Domain Number - Region: 754-800
Classification Level Classification E-value
Superfamily S13-like H2TH domain 0.0718
Family Topoisomerase VI-B subunit middle domain 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) U1PK22
Sequence length 1330
Comment (tr|U1PK22|U1PK22_9EURY) Type II DNA topoisomerase VI subunit B {ECO:0000256|HAMAP-Rule:MF_00322} KW=Complete proteome OX=1238424 OS=Haloquadratum walsbyi J07HQW1. GN=J07HQW1_02580 OC=Haloquadratum.
Sequence
MTSFQSTLGEEGEIADELAESQRAISIAEFFEKNKHMLGFDSGARGLVTAVKEAVDNALD
ATEEAGIKPDISIEIRESGDYYTLIVEDNGPGITREQVPKVFGKLLYGSRFHAREQSLTP
TQTLLLRHDGDITFTSIGEFCDSYLPADGEASAPIPADANIEVPSFDRQTHEMTWQPVTN
AIRHRTDERVYRISTACGRTVETTGNHSLFSLSSHDETVEVNASELSAGDTILAPKQLPM
VSQSAETGVTVETETKTTEREQTINILEYIQSDDLRRSEHTFRIRDRHSASPSPSSAGDT
PSASTASSASSNLTSTAVASSTGGQQSHVSVDQRQPEPESHTLDDTQDGESYRSGETVCE
HDEASSVADCILEIVDPSGEVIRLPISVSIDETFIESLARYIVFGSPSAILQTSAGNEDH
TTKEGHHTLDTSLDDTSTPLDSVIPLLCKDAGDIQLPSFIFECDAKHQQQLLTQLYQYSD
VSNAVDTGDDNVTYTTSNATLARQLTTLWNMNGVVATTDTRIKTQTETKTSRSGDLTRES
AQTTIYYVSVNQTQAEFDTKSDVGTGTESDHQHDTGDLCLLSVSNVEEIDAPSYVYDISV
PGASGHDENFVTVNDGAICVKNSRGQQGIGISAAVLYSQLTSGKPAKITTRTQSSDTAQY
FELIIDTDTNEPEVSADQERDPGAASLSPTHGTRIELEMEANMRARGQLRDYVKHTAVVN
PHARITLDEPGLEEPRQYERVDGAELPAQTEEIRPHPHGVELGTLLKMLEATESYSVSGF
LREEFTRVGSKTATKILDRFRDRHFGRALPMSAPETIPNSTGETDESDVDGDENENDNDQ
MSSSLESVIDAAVINKGASATATFADRVAKTLNQRSGTTRSELAGIVDTVAEDIEDEFET
TFGATVRENAVDAAWDVLTTHIDDDIYPLVADATSTQKDHTTVRGVADRIAAKFADGSGS
LRATRDTVREYVDRSADMIVSEEVSFGETARENVVDAVWTAMQTVEDELPAVQTVADDRN
IASELLEAMRSTDILAPPTDCLSPITADLVEAGLRKEFDADFYAAATRDAEVHGGDPFVV
EAGVAYGGELEGGNISLLRFANRVPLVYQRGACATTDVIKSIGWRNYGLDQPGGSGMPRG
PAVVMIHVASTNVPFTSESKDALANIPAIENEIELAVREASRELKSYLNKRRSMQKRRKK
QDVLGRILPEMANKLADVTENDRPDIDNALARIMNNVSVERDINDGSVTLTVQNYSDRQE
SPTLTDIVDSKPETIPAEMEVVELEGEYFLTWEPTVAAGESATVTYEVPTNASFELDVDD
VETEKLTIDA
Download sequence
Identical sequences U1PK22

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]