SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for U1PZH8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  U1PZH8
Domain Number 1 Region: 894-1059
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.1e-55
Family DNA gyrase/MutL, second domain 0.0000229
Further Details:      
 
Domain Number 2 Region: 118-236,461-505
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 3.53e-25
Family Intein (protein splicing domain) 0.017
Further Details:      
 
Domain Number 3 Region: 28-116
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 2.88e-18
Family DNA gyrase/MutL, N-terminal domain 0.0044
Further Details:      
 
Domain Number 4 Region: 503-612
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 0.0000044
Family DNA gyrase/MutL, N-terminal domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) U1PZH8
Sequence length 1188
Comment (tr|U1PZH8|U1PZH8_9EURY) Type II DNA topoisomerase VI subunit B {ECO:0000256|HAMAP-Rule:MF_00322} KW=Complete proteome; Reference proteome OX=1238426 OS=Haloquadratum sp. J07HQX50. GN=J07HQX50_02013 OC=Haloquadratum.
Sequence
MTSFQSSLDEKEGEIATELAESQRSISIAEFFEKNKHMLGFDSGARGLVTAVKEAVDNAL
DATEEAGIRPDISVEIRETGSYYTLIVEDNGPGITKEQLPKVFGKLLYGSRFHAREQSLP
GAQSLLINRDGCVEFVPIGDFCDNYLPEQTAAVAPVSDDITVPSFNRQTQQISWQPVTTA
IRHETEAAVYEVKTTAGRTVTVTGDHSLFCLSDSGEIQEVAGGELETGDSIMVPKQIPTV
GSSSASDTTEQMSSVAALCSETTAESLSTDGGLQAKDATDPSPDRLQTLLRSLINESRSA
SSLSVAEQRALTRSLATYVTCRGAIVPDHRQPISVNSASSQTLSLFEMFDTCCTSDDGYT
LPGFLFEVHPSAQRAFVAQAFAVDVSDESVPQASVSVGTAHLLRELTTLCTQIGLMPQLT
TADAVDADSGHTLTICSHETNGPQQQSPQSSHHISLGSPLRNETIQEVTQVAQPDTVYDI
SVPGATGADENFIIANEAPVFVKNSRGQQGIGISAAVLYSQLTSGKPAKITSRTQSASQS
QYFELIIDTDTNEPEIQRSMSQDPTESELSPTHGTRIELEMEANLRARQQLHDYIKHTAV
VNPHARITLDEPNISGPIQYDRVDGAELPAETEEIRPHPHGVELGTLLKMLESTESYSLS
GFLQAEFTRVGTKTTTRIVDRFRDRYFGREIGWSIPESSTDDAVESIIDAVANKPADATE
AFATQITETVVSRERTTHQQLQTIIETIAEDIEDEYRTTFAATVRQRAHTAMWQVLTADL
SDDIFELVEQATSQQKDESTLNGLTTRLETKLQDHDKQHRLTREVLAEYVNRSADQLETQ
EITFGETARGNVAEAFWDVMNTVNDSVPQVSAVGDDRDTASSLLEAMRETDILAPPTNCL
SPISEELVEAGLRKEFDADFYAAATRDAEVHGGDPFVVEAGIAYGGQLDNTSMRLLRFAN
RVPLVYQQGACATTDVIKQIRWRNYGLNQPGGSGLPQDSIVLMIHVASTNVPFTSESKDA
LANIPAIENEIELAVREASRDLKSFLNKRRSMQKRRKKQDVLSRILPEMAHKLAEVTGRQ
EPDIDSALARIMNNVSIERQIEETAVTLKVRNHSDRNETPEITEIVSAEPQNVPDDVDSV
NMDGEWFLTWNPTVKAGDTVQFSYRAVSDATFDIQIDGIETEKLTLNV
Download sequence
Identical sequences U1PZH8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]