SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for U2X2J4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  U2X2J4
Domain Number 1 Region: 2-235
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.67e-59
Family ABC transporter ATPase domain-like 0.00000139
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) U2X2J4
Sequence length 241
Comment (tr|U2X2J4|U2X2J4_GEOKU) Branched chain amino acid ABC transporter ATP-binding protein {ECO:0000313|EMBL:GAD12717.1} KW=Complete proteome OX=1337888 OS=Geobacillus kaustophilus GBlys. GN=GBL_0934 OC=Geobacillus thermoleovorans group.
Sequence
MLVLRNVHVYHGHLHVLKGVSLQVDEGKIVTVVGANGAGKSTLLGTIAGVYAPTEGEILF
EHKPLPYGKVEQIVEKGICLVPERRQIFDSLSVRDNLLLGAYRRHRRDGQEVKRDYERVL
ELFPKLQTMLDRPGGLLSGGEQQMLAIARGLMARPKLLLLDEPSLGLAPLVVKEVMGMLT
QLCDQFQTAMILVEQNVRAALQTADEAYVLERGSIVVHGKAAELLADERVAEAYLGAAGR
R
Download sequence
Identical sequences A0A063YLW3 A0A098L165 A0A1C3DA19 A0A1Q5SY92 A0A1V9BRP7 A0A2H5KJL2 G8N7I5 Q5KVH9 T0P1J1 U2X2J4 V6VFN8
gi|375010150|ref|YP_004983783.1| 235909.GK3022 WP_011232492.1.100150 WP_011232492.1.2219 WP_011232492.1.22479 WP_011232492.1.25743 WP_011232492.1.45808 WP_011232492.1.60903 WP_011232492.1.6497 WP_011232492.1.70239 WP_011232492.1.77642 WP_011232492.1.78869 WP_011232492.1.8599 WP_011232492.1.90668 WP_011232492.1.91533 WP_011232492.1.92435 WP_011232492.1.93593 gi|56421557|ref|YP_148875.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]