SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for U2Y5S6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  U2Y5S6
Domain Number 1 Region: 33-67
Classification Level Classification E-value
Superfamily Outer membrane lipoprotein 0.0000565
Family Outer membrane lipoprotein 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) U2Y5S6
Sequence length 123
Comment (tr|U2Y5S6|U2Y5S6_GEOKU) Uncharacterized protein {ECO:0000313|EMBL:GAD11983.1} KW=Complete proteome OX=1337888 OS=Geobacillus kaustophilus GBlys. GN=GBL_0200 OC=Geobacillus thermoleovorans group.
Sequence
MDGELRALLNAVLERLDVQGAYIEQMRMDIVKLQGSVKQLEDKVDRLQSDVDAMKKDMDA
MKKDMDAMKKDMDAMKKDMLGVKKDVAALKEGQVRQEKIMERLAIRSIEQEAEIDELRKE
ISA
Download sequence
Identical sequences A0A098L0S4 A0A0K1KA13 A0A146CSW3 A0A1C3DAC8 A0A1V9BWR8 G8N4U2 Q5KWE3 U2Y5S6 V6VFS7
gi|375009819|ref|YP_004983452.1| gi|56421243|ref|YP_148561.1| WP_011232182.1.2219 WP_011232182.1.22479 WP_011232182.1.25743 WP_011232182.1.46395 WP_011232182.1.60903 WP_011232182.1.62042 WP_011232182.1.6497 WP_011232182.1.70239 WP_011232182.1.78869 WP_011232182.1.8599 WP_011232182.1.90668 WP_011232182.1.91533 WP_011232182.1.93593 WP_011232182.1.93963 WP_011232182.1.97756 235909.GK2708

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]