SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for U3D8R2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  U3D8R2
Domain Number 1 Region: 641-896
Classification Level Classification E-value
Superfamily YWTD domain 8.5e-56
Family YWTD domain 0.00000539
Further Details:      
 
Domain Number 2 Region: 29-289
Classification Level Classification E-value
Superfamily YWTD domain 1.31e-51
Family YWTD domain 0.00000168
Further Details:      
 
Domain Number 3 Region: 340-570
Classification Level Classification E-value
Superfamily YWTD domain 1.57e-51
Family YWTD domain 0.00000262
Further Details:      
 
Domain Number 4 Region: 943-1202
Classification Level Classification E-value
Superfamily YWTD domain 2.35e-38
Family YWTD domain 0.0000725
Further Details:      
 
Domain Number 5 Region: 1331-1366
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000825
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 6 Region: 596-642
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000428
Family EGF-type module 0.0095
Further Details:      
 
Domain Number 7 Region: 1293-1329
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000445
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 8 Region: 1253-1291
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000576
Family LDL receptor-like module 0.00086
Further Details:      
 
Domain Number 9 Region: 899-946
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000001
Family EGF-type module 0.026
Further Details:      
 
Domain Number 10 Region: 295-337
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000129
Family EGF-type module 0.012
Further Details:      
 
Domain Number 11 Region: 1210-1262
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000931
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) U3D8R2
Sequence length 1611
Comment (tr|U3D8R2|U3D8R2_CALJA) Low-density lipoprotein receptor-related protein {ECO:0000256|PIRNR:PIRNR036314} OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=LRP5 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MEAAPPRPPWPLLLLLVLGGCSAPAAASPLLLFANRRDVRLVDAGRVKLETTVVVSGLED
AAAVDFQFSKGVVYWTDVSEEAIKQTYLNHTGVAVQNVVISGLVSPDGLACDWVGKKLYW
TDSETNRIEVANLNGTSRKVLFWQDLDQPRAIALNPAHGYMYWTDWGEMPRIERAGMDGT
TRNIIVDSDIYWPNGLTIDLEEQKLYWADAKLSFIHRANLDGSFRQKVVEGSLTHPFALT
LSGDTLYWTDWQTRSIHACNKRTGGKRKEILSALYSPMDIQVLSQERQPFFHTRCEEDNG
GCSHLCLLSPVEPFYKCACPTGVQLQDNGRTCKAGAEEVLLLARRTDLRRISLDTPDFTD
IVLQVDDIRHAIAIDYDPLEGYVYWTDDEVRAIRRAYLDGSGAQTLINTDINDPDGIAVD
WVARNLYWTDTGTDRIEVTRLNGTSRKILVSEDLDEPRAIALHPVMGLMYWTDWGENPKI
ECANLDGQERRVLVNASLGWPNGLALDLQEGKLYWGDAKTDKIEVINVDGTKRRTLLEDK
LPHIFGFTLLGDFIYWTDWQRRSIERVHKVKASRDIIIDQLPDLMGLKAVNVAKIMGTNP
CADENGGCSHLCFFTPRSTRCGCPIGLELLSDMKTCIVPEAFLVFTSRAAIHRISLETNN
NDVAIPLTGVKEASALDFDVANNHIYWTDVSLKTISRAFLNGSSVEHVVEFGLDYPEGMA
VDWMGKNLYWADTGTNRIEVARLDGQFRQVLVWRDLDNPRSLALDPTEGYIYWTEWGGKP
RIVRAFMDGTNCMTLVDKVGRANDLTIDYTDRRLYWTDLDTNMIESSNMLGQERVVIADD
LPHPFGLTQYSDYIYWTDWNLHSIERADKTSGQNRTLIQGHLDFVMDILVFHSSRQDGLN
DCVHDNGQCGQLCLAIPGGHRCGCASHYTLDPSGRNCSPPTTFLLFSQKSAISRMIPDDQ
HSPDLVLPLHGLRNVKAIDYDPLDKFIYWVDGRQNIKRAKDDGTQPFVLTSLSQAQNPDR
QPHDLSIDIYSRTLFWTCEATNTINVHRLSGEAIGVVLRGDRDKPRAIVVNAERGYLYFT
NMQDRAAKIERAALDGTEREVLFTTGLIRPVALVVDNALGKLFWADADLKRIESCDLSGA
NRLTLEDANIVQPLGLTVLGKHLYWIDRQQQMIERVEKTTGDKRTRIQGRVTHLTGIHAV
EDVSLEEFSAHPCARDNGGCSHICIAKGDGTPRCSCPVHLVLLQNLLTCGEPPTCSPDQF
ACATGEIDCIPGAWRCDGFPECDDQSDEEGCPVCSAAQFPCARGQCVDLRLRCDGEADCQ
DRSDEADCDAICLPNQFRCASGQCVLIKQQCDSFPDCIDGSDELMCEINKPPSDDTGAHS
SAIGPVIGIILSLFVMGGIYFVCQRVVCQRYAGANGPFPHEYVSGTPHVPLNFIAPGGSQ
HGPFTGIACGKSMMSSVSLMGGRGGVPLYDRNHVTGASSSSSSSTKATLYPPILNPPPSP
ATDPSLYNMDMFYSSNIPATTRPYRPYIIRGMAPPTTPCSTDVCDSDYSASRWKASKYYL
DLNSDSDPYPPPPTPHSQYLSAEDSCPPSPATERSYFHLFPPPPSPCTDSS
Download sequence
Identical sequences U3D8R2
XP_009006861.2.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]