SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for U3DKU7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  U3DKU7
Domain Number - Region: 123-173
Classification Level Classification E-value
Superfamily Cgl1923-like 0.00706
Family Cgl1923-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) U3DKU7
Sequence length 247
Comment (tr|U3DKU7|U3DKU7_CALJA) Gamma-secretase subunit APH-1A isoform 2 {ECO:0000313|EMBL:JAB13976.1} OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=APH1A OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MGAAVFFGCTFVAFGPAFALFLITVAGDPLRVIILVAGAFFWLVSLLLASVVWFILVHVT
DRSDARLQYGLLIFGAAVSVLLQEVFRFAYYKLLKKADEGLASLSEDGRSPISIRQMAYV
SGLSFGIISGVFSVINILADALGPGVVGIHGDSPYYFLTSAFLTAAIILLHTFWGVVFFD
ACERRRYWALGLVVGSHLLTSGLTFLNPWYEASLLPIYAVTVSMGLWAFITAGGSLRSIQ
RSLLCKD
Download sequence
Identical sequences A0A2J8VEM2 F7FDJ7 G2HHW2 U3DKU7
ENSP00000353380 ENSP00000464506 gi|117606357|ref|NP_057106.2| ENSP00000353380 NP_001267034.1.37143 NP_057106.2.87134 NP_057106.2.92137 ENSMMUP00000028174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]