SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for U3I003 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  U3I003
Domain Number 1 Region: 102-478
Classification Level Classification E-value
Superfamily Cysteine proteinases 3.73e-91
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.00000000000265
Further Details:      
 
Domain Number 2 Region: 5-92
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.59e-23
Family Ubiquitin-related 0.0000128
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) U3I003
Sequence length 492
Comment (tr|U3I003|U3I003_ANAPL) Ubiquitin specific peptidase 14 {ECO:0000313|Ensembl:ENSAPLP00000000573} KW=Complete proteome; Reference proteome OX=8839 OS=Anas platyrhynchos (Mallard) (Anas boschas). GN=USP14 OC=Anatinae; Anas.
Sequence
ILLFAVNVKWGKEKFDGVELNTDEPPMVFKAQLFALTGVQPARQKVMVKGGTLKDDDWGN
LKIKNGMTLLMMGSADALPEEPIARPVFVEDMTEEQLASAMELPCGLTNLGNTCYMNATV
QCIRSVPEVKEALKRYGGALRASGEMASAQYITAALRDLFDSMDKTSSSIPPIILLQFLH
MAFPQFAEKGDQGQYLQQDANECWVQMMRVLQQKLEGIEGDTVMETDSGAAATTSKKKSL
IDQFFSIEFETAMKCTEAEEEEVTKGKENQLQLSCFINQEVKYLFTGLKLRLQEEITKLS
PTLQRNALYIKSSKISRLPAYLTIQMVRFFYKEKESVNAKVLKDVKFPLMLDVYELCTPD
LQEKMVSYRSKFKDLEDKKVNQQPKNSSKSDGAQKEVKYEPFSFPDDIGSNNCGYYDLQA
VLTHQGRSSSSGHYVSWVKRKQDEWIKFDDDKVSIVTPEDILRLSGGGDWHIAYVLLYGP
RRIEVIEDEAEQ
Download sequence
Identical sequences U3I003
ENSAPLP00000000573

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]