SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for U3I0W4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  U3I0W4
Domain Number 1 Region: 7-350
Classification Level Classification E-value
Superfamily Cullin repeat-like 2.88e-113
Family Cullin repeat 0.0000000000141
Further Details:      
 
Domain Number 2 Region: 349-620
Classification Level Classification E-value
Superfamily Cullin homology domain 1.06e-101
Family Cullin homology domain 0.000000000208
Further Details:      
 
Domain Number 3 Region: 620-708
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 5.99e-28
Family SCF ubiquitin ligase complex WHB domain 0.000011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) U3I0W4
Sequence length 708
Comment (tr|U3I0W4|U3I0W4_ANAPL) Cullin 4A {ECO:0000313|Ensembl:ENSAPLP00000000884} KW=Complete proteome; Reference proteome OX=8839 OS=Anas platyrhynchos (Mallard) (Anas boschas). GN=CUL4A OC=Anatinae; Anas.
Sequence
ERPKLPDNYTQDTWQKLHDAVIQSSVSIRYNLEELYQAVENLCSYKVSATLYKQLRQVCE
DHVKAQILQFREYSLDSLLFLKKINKCWQDHCRQMIMIRSIFLFLDRTYVLQNSMLPSIW
DMGLELFRNHVISDKQVQNKTIDGILLLIERERSGEAVDRSLLRSLLSMLSDLQVYKESF
EQRFLEETNCLYAAEGQRLMQEREVPEYLHHVNKRLEEEGDRVITYLDHSTQKPLIACVE
KQLLGEHLTAILQKGLDNLLDENRISDLTQTYQLFSRVKGGQQILLQHWSEYIKNFGTTI
VVNPEKDKDMVQELLDFKDKVDHIIEVCFQKNEKFINLMKESFETFINKRPNKPAELIAK
YVDSKLRAGNKEATDEELERILDKIMIIFRFIHGKDVFEAFYKKDLAKRLLVGKSASVDA
EKSMLSKLKHECGAAFTSKLEGMFKDMELSKDVMVQFKQYMQNQSDPGNIDLTVNILTMG
YWPTYTPMEVHLNSEMIKLQEVFKTFYLGKHSGRKLQWQTTLGHAVLKAEFKEGKKEFQV
SLFQTLVLLMFNEGDEFSFEEIKMATGIEDSELRRTLQSLACGKARVLIKNPKGKDVEDG
DKFIFNGDFKHKLFRIKINQIQMKETVEEQVSTTERVFQDRQYQIDAAIVRIMKMRKTLG
HNLLVSELYNQLKFPVKPGDLKKRIESLIDRDYMERDKDNPNQYHYVA
Download sequence
Identical sequences U3I0W4
ENSAPLP00000000884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]