SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for U3I3S1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  U3I3S1
Domain Number 1 Region: 16-145
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.12e-25
Family DEP domain 0.018
Further Details:      
 
Domain Number 2 Region: 223-298,589-684
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.00000000000000137
Family BCR-homology GTPase activation domain (BH-domain) 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) U3I3S1
Sequence length 812
Comment (tr|U3I3S1|U3I3S1_ANAPL) DEP domain containing 1 {ECO:0000313|Ensembl:ENSAPLP00000001892} KW=Complete proteome; Reference proteome OX=8839 OS=Anas platyrhynchos (Mallard) (Anas boschas). GN=DEPDC1 OC=Anatinae; Anas.
Sequence
EAPNGEPRGAFEPSRQWNEITRYFRAGMPLRKHRQRFKKHGSCFTASEAVDWLHQVLRSN
SNFGPEVSRQQTVQLLRKFLKNHVIEDIKGRWGSEDLEDNGVLYRFPSTSPVKPLPSSRR
EKENLETFSRDKERLFKLPHLSRRTVKKHELLDSLENLEKTEPDITKENKEDELHRKEIS
QEYVQEIWRNIILIHLQTILGLPSLEEILQPTQIVPEYVIYNMTNTSKHGVVILQNKSED
LPHWVLSAMKCLAYWPRNNDMNQPTYSGFERDVFRTVADYFLNLPEPLLTFEYYELFVNI
LVMCGYIKIPDLCSRKHSVQDETCDPQPSKILHLNSFKSTECLLLSLLCKEPEKKKKEYE
VSRKWSAEESAVQKQCAKKLQQYKLRSEQGSVDNLIGGSCQNLSGFRNEKDSALKFRTRC
YSLERIGGTASSVRNKGESVVLRQTDVNTVLGIRSKNQSLPYEHKANSALAFGFDNTYQN
QTYGVKTASASTLQDKELLDENHRSKEICRSQSLLGSRNSKSCTSINIPVAEITVKPTSQ
LCGQRKPNAAVDIRTEVSDITVSKRLCKSTIELSEYSFTHSCMLTGTQNLLQPHLERIAV
EALQICCLLLPPPNRRKMQLLMRMISRISENVDMPRLHDAMGTRSLMIQTFSRCVLCCAE
EVDLDELLSTRLVSFLMDHQQEIFKVPTYLQVAVQDHIEYMRMAQGKYPREEICAILPTY
SYCKQITPQEFEEQKVSTSQAAVAELLENIIKDKNLSVKDKKKKLKQFQKEYPLIYQNRF
PTTESEAILFENKPTIKQPMLSLRKPKFRSLR
Download sequence
Identical sequences U3I3S1
ENSAPLP00000001892

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]