SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for U3I6Z9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  U3I6Z9
Domain Number 1 Region: 44-136
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.9e-38
Family Forkhead DNA-binding domain 0.0000348
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) U3I6Z9
Sequence length 239
Comment (tr|U3I6Z9|U3I6Z9_ANAPL) Forkhead box L2 {ECO:0000313|Ensembl:ENSAPLP00000003020} KW=Complete proteome; Reference proteome OX=8839 OS=Anas platyrhynchos (Mallard) (Anas boschas). GN=FOXL2 OC=Anatinae; Anas.
Sequence
SSYPDAEEDAVALLAHDSGGSKEPERGKEELGADKGPEKPDPSQKPPYSYVALIAMAIRE
SAEKRLTLSGIYQYIISKFPFYEKNKKGWQNSIRHNLCLNECFIKVPREGGGERKGNYWT
LDPACEDMFEKGNYRXXXXXXXXXXXXXXXXXXXXPDSYGYLSPPKYLQSTFMNNSWPLA
QPPAPMPYASCQMSGGNVSPVNVKGLXXXXXXXXXCQLASVALPGIVMKTFFGHLHQYY
Download sequence
Identical sequences U3I6Z9
ENSAPLP00000003020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]