SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for U3I7K9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  U3I7K9
Domain Number 1 Region: 146-250
Classification Level Classification E-value
Superfamily TAFH domain-like 5.49e-35
Family TAFH domain-like 0.0000298
Further Details:      
 
Domain Number 2 Region: 531-579
Classification Level Classification E-value
Superfamily Histone-fold 0.000000000000067
Family TBP-associated factors, TAFs 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) U3I7K9
Sequence length 744
Comment (tr|U3I7K9|U3I7K9_ANAPL) TATA-box binding protein associated factor 4b {ECO:0000313|Ensembl:ENSAPLP00000003230} KW=Complete proteome; Reference proteome OX=8839 OS=Anas platyrhynchos (Mallard) (Anas boschas). GN=TAF4B OC=Anatinae; Anas.
Sequence
PTGTVLIRSSSGQLMLVSQQAIARAQTQPQNNTSIQPSVPSSTPTVRICAVQNSGTQLLK
KAVVTPVKTLSQTTNAVVSTVQPPAVIQPAAATASVTTVTAVKPSSTGTPVKLPVTGPPA
QSISQKAVSVKAEGTTVAQTSASAEMLENVKKCKNFLATLIKLASSGPQAPEMGQNVKNL
VQNLLEAKIEPEEFTKKLYIELKSSPQPYLVPFLKKSMLALRQLMPNAQSFIQQCMQQPA
PTQEAVSTCTSAPTPAVVAASAVATNSLPVIKPASASATVTASPVTKPVLPSAPVTASLQ
TVKPVPASAVVTASLRPAASVLTTTTVTSGLTAIQTVKPVFTSAVATSSLQPVKPVLVSA
VASSAATPLQPLKPVIGTPISIKISQPNSIVAQSAGAQQVVKVKQLVVQQPSGAIVKQVS
TLPQPSTLTLQTSAEKRMPLNTLVQTNKFPAGSILKQVTLPGNKILSLQASPVQKTKIKE
NGTTSFSRDEDDINDVTSMAGVNLSEESECILATNSELIGTVIRSCADEPFLSSEALQKK
ILNIGKRHDIMELNSDVVNLISHATQERLRGLLEKLTVIAQHRVSTHKGSDKYIVSSDTR
AQLRFLEKLDHLEKQRKDEEEREMLLRAAKSRSNKEDPEHLRLKQKAKEMQQLELAQMQQ
REANLTALAAIGPRKKRPLDSSNAGSGLEGLNGNGVAPGSSNFSLTKQLLRPRITRVCLR
DLIFCMEQEREMKHSLTLYRALLK
Download sequence
Identical sequences U3I7K9
ENSAPLP00000003230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]