SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for U3I850 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  U3I850
Domain Number 1 Region: 3-347
Classification Level Classification E-value
Superfamily Cysteine proteinases 5.1e-83
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.0000132
Further Details:      
 
Domain Number 2 Region: 380-469
Classification Level Classification E-value
Superfamily DUSP-like 0.0000000000000602
Family DUSP, domain in ubiquitin-specific proteases 0.008
Further Details:      
 
Domain Number 3 Region: 866-921
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000612
Family Ubiquitin-related 0.0079
Further Details:      
 
Weak hits

Sequence:  U3I850
Domain Number - Region: 654-706
Classification Level Classification E-value
Superfamily DUSP-like 0.000536
Family DUSP, domain in ubiquitin-specific proteases 0.012
Further Details:      
 
Domain Number - Region: 563-601
Classification Level Classification E-value
Superfamily DUSP-like 0.00824
Family DUSP, domain in ubiquitin-specific proteases 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) U3I850
Sequence length 954
Comment (tr|U3I850|U3I850_ANAPL) Ubiquitin specific peptidase 48 {ECO:0000313|Ensembl:ENSAPLP00000003421} KW=Complete proteome; Reference proteome OX=8839 OS=Anas platyrhynchos (Mallard) (Anas boschas). GN=USP48 OC=Anatinae; Anas.
Sequence
NAFVGLTNLGATCYVNTFLQMWFLNLELRQALYLCPSTCSEHTAGEGVPKDKDYEPQTIC
EHLQYLFALLQNSKRRYIDPSGFVKALGLDTGQQQDAQEFSKLFMSLLEDTLSKQKNPDV
RNIVQKQFCGEYAYVTVCNQCGRESKLVSKFYELELNIQGHKQLTDCITEFLKEEKLEGD
NRYFCETCQSKQNATRKIRLLSLPCTLNLQLMRFVFDRQTGHKKKLNTYIGFSELLDMEP
FMEQKSGVYVYELSAVLIHRGVSAYSGHYIAHVKDPQTGEWYKFNDEDIEKMEGKKLQLG
IEEDLAEPSKSQTRKPKCGKGTHCSRNAYMLVYRLQTREKSLTVEVPAFLQELVERDNCK
FEEWCNEMAEMRKQSVARGKIKHEEVKELYQRLPAEAGSPYDFISLEWLQKWLDESTPPK
PIDNTACLCSHGKLHPDKICIMKRISEYVADFFYRRYGGGPRLNVKALCKDCVVERCRIL
RLKNQLNEDYKTVTNLLKITVKGNDGFWVGKASLRSWRQLALEQLNEQDEDAEHSNGKMN
GNAQNKDELSEEKREEEEELNFNEDIVCPHGDLCISENERRVVSKEAWKKLKQYFPKAPE
FPNNKECCSQCKILEREGEENEALHKMMASEQKTSLQNLFHDKCRPCLGSWPQETDELYI
VSQFFVEEWRKFVSLSRRPTRCSPVSSVGNSALLCPHGGLMFTYASMTKEDSKLIALIWP
SEWERIQKLFVVDHVIKITRTEAAGADPESALYTSEPKLCPECREGLLCQQQRDLREYTQ
ATIYIHKVVDNKKVMKDAAPELNVSSSEAEEEREEHKPEGEQDPDFNQTNGGAKRQKISH
QNYITYQKQGIRRSTRHRKVRGEKALLVSANQTLKELKIQIMHAFSVAPFDQNLSIDGKI
LSDDTATLGSLGVIPESVILLKADEPLADYAAMDDVMQVCMPEEGFKGTGLLGH
Download sequence
Identical sequences U3I850
ENSAPLP00000003421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]