SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for U3I879 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  U3I879
Domain Number 1 Region: 120-214
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.49e-37
Family Forkhead DNA-binding domain 0.0000832
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) U3I879
Sequence length 438
Comment (tr|U3I879|U3I879_ANAPL) Forkhead box J1 {ECO:0000313|Ensembl:ENSAPLP00000003450} KW=Complete proteome; Reference proteome OX=8839 OS=Anas platyrhynchos (Mallard) (Anas boschas). GN=FOXJ1 OC=Anatinae; Anas.
Sequence
MAEGWLSLRVADRGQEGGGMGDSSDLDDSLTSLQWLQEFSIINANLGKSSSCPSGPDPHD
YHHLPGFAAPCSPLAADPACMGMPHTPGKPTSSSTSRTAPPVGGVQPPAEDIDYKTNPHV
KPPYSYATLICMAMEASKKSKITLSAIYKWITDNFCYFRHADPTWQNSIRHNLSLNKCFI
KVPREKDEPGKGGFWKIDPQYADRLMNGAFKKRRMPPVQIHPAFTSRAQQETRCGTGPVA
STWTNGNVLNVNVESQQLLKEFEEVTGDQNWNPADGKASRKRKQPLPKRTAKLSRLSNPA
LLTQEEQTELGSLKGDFDWEAIFDTNLNGDFSTFEDLELTPPISPIRRDVDLTVQGRHID
CPQDWCTTTGHEQVLSESSQNNLDFDETFMATSFLQHPWDEGRNDYLSGSVGVEQLFELS
DTSLAADVNDWSSVGSFL
Download sequence
Identical sequences U3I879
ENSAPLP00000003450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]