SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for U3ICL0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  U3ICL0
Domain Number 1 Region: 3-93
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.38e-29
Family Ubiquitin-related 0.0000659
Further Details:      
 
Domain Number 2 Region: 100-154
Classification Level Classification E-value
Superfamily Zn-binding ribosomal proteins 5.13e-21
Family Ribosomal protein S27a 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) U3ICL0
Sequence length 156
Comment (tr|U3ICL0|U3ICL0_ANAPL) Ribosomal protein S27a {ECO:0000313|Ensembl:ENSAPLP00000004982} KW=Complete proteome; Reference proteome OX=8839 OS=Anas platyrhynchos (Mallard) (Anas boschas). GN=RPS27A OC=Anatinae; Anas.
Sequence
LLLYLTCASGQNLEEKVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRE
CPSEECGAGVFMASHFDRHYCGKCCLTYCFNKPEDK
Download sequence
Identical sequences U3ICL0
ENSAPLP00000004982

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]