SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for U3IDC4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  U3IDC4
Domain Number 1 Region: 52-153
Classification Level Classification E-value
Superfamily E2F-DP heterodimerization region 1.52e-33
Family E2F dimerization segment 0.0011
Further Details:      
 
Domain Number 2 Region: 8-39
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000000789
Family Cell cycle transcription factor e2f-dp 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) U3IDC4
Sequence length 354
Comment (tr|U3IDC4|U3IDC4_ANAPL) E2F transcription factor 4 {ECO:0000313|Ensembl:ENSAPLP00000005246} KW=Complete proteome; Reference proteome OX=8839 OS=Anas platyrhynchos (Mallard) (Anas boschas). GN=E2F4 OC=Anatinae; Anas.
Sequence
AADTLAVRQKRRIYDITNVLEGIGLIEKKSKNSIQWKGVGPGCNTREIAHKLIELKADIE
DLEQREQELEQQKMWVQQSIKNVTEDVQNKTLAYVTHEDICKCFTGDTLLAIRAPSGTRL
EVPIPEGPNGQKKYQIHLKSTSGPIDVLLVNKDAWSSPPVVLPVPPPEDLIQCQAVAPSK
PQIPPLAHFQEASVPSSTQPSTPTPSSTQDHSPPAQKAPSTEGSVSVAEPKSSGDLDPLS
TVPTSSSQTAGLDTQPLQSSASLDSSSVLPSPSTSFEPIKPDPTGMLELPKELSEMFDPT
RECMNSELLEELMSSEVFAPLLRLSPPPGDHDYIYNLDESEGVCDLFDVPVLNL
Download sequence
Identical sequences U3IDC4
ENSAPLP00000005246

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]