SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for U3IEF1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  U3IEF1
Domain Number 1 Region: 913-1090
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.3e-48
Family BCR-homology GTPase activation domain (BH-domain) 0.00018
Further Details:      
 
Domain Number 2 Region: 491-608
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 8.5e-36
Family Pyk2-associated protein beta ARF-GAP domain 0.0008
Further Details:      
 
Domain Number 3 Region: 257-376
Classification Level Classification E-value
Superfamily PH domain-like 4.72e-25
Family Pleckstrin-homology domain (PH domain) 0.00025
Further Details:      
 
Domain Number 4 Region: 1222-1324
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000155
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 
Domain Number 5 Region: 3-70
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000000000209
Family SAM (sterile alpha motif) domain 0.0047
Further Details:      
 
Domain Number 6 Region: 394-491
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000403
Family Pleckstrin-homology domain (PH domain) 0.025
Further Details:      
 
Domain Number 7 Region: 603-788
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000938
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 
Domain Number 8 Region: 804-913
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000367
Family Pleckstrin-homology domain (PH domain) 0.028
Further Details:      
 
Domain Number 9 Region: 1118-1204
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000655
Family Ras-binding domain, RBD 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) U3IEF1
Sequence length 1547
Comment (tr|U3IEF1|U3IEF1_ANAPL) ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 3 {ECO:0000313|Ensembl:ENSAPLP00000005623} KW=Complete proteome; Reference proteome OX=8839 OS=Anas platyrhynchos (Mallard) (Anas boschas). GN=ARAP3 OC=Anatinae; Anas.
Sequence
MSSPCSPDSDIADWLATIHLERYRDVFKQHGIHVARDALTLDGDHLQQLGITATGHRKRI
LNLAQQTRLRAQPRAGSPHPRAPPMEKDPSPPLVKPVPKPRTVFYRPKSEPGSAPTPPAR
TTAPAQSPNGAPTAFVVLEGFVPGESSTDMESPGTAPAMGTGEGRGGRAARIEDPLPHGT
PTLGRITLPVPFPGSAWFGVEDAAVPPRPPRTSSECSSEGRSEDEETRTRLIERIAQNDT
EGYSTVEAPRAEGTPFSLPPHLYPDEVLDDLTISPYASYTSLSEPRPTMLSGWLDKLSPQ
GNYVFQRRYVRFDGKNLMYFSSEKESYPKGVIPLSVIEMVRASKDNKFQVVTSHRIFVFR
AENEAQRNEWCSTLQKKVTDQRLGGSRPRPPNTAHCQKSGTLELKGQKSKVFAALSLPEM
WLYKSEQFFKMGIGICVIEMRGSTIREAKNRSFELITPSKIFSFVAESERDKREWMEALQ
EAIAEMLYDYEVAEKIWSNKANKYCADCQAQNPDWASINLCVVICKQCAGQHRSLGSNIS
KVQSLKLDTSVWSNEIVQLFIVLGNDRANRFWAARLPTAEALHPDASAEQRRDFIARKYR
DGRYRLPHPHYATQEEVLQALCTAVAAPGLLKTILQFFSSSEAGLAAEPAAYEMAPGADP
WFLTGEPGPEGVYNEITQPVTHSGYLHRATAPPRLPGTRKSREDFQRVWCSLEKSLLFFE
TEKCTEPLGHIESGELLSLGVSRAQAPTNPGTTERFRFTLELFLTGEKVQQLGADSPETL
QAWASTIGKWFTPMSCHCLLGYEFQRAGQLRYKCMLNPERWQQAFFILQKAHLFICPAEE
DGAEDSINLRRLQELSLVPPTDTPEKREMLLLVEMGRTFYLQGLSRADTAAWYADIQAAA
GGRGNALRDQQLSRGDIPIIVDSCIAFITQYGLRHEGIYRKNGAKSRIKVLMEEFRRDAR
NVKLRISDNFIEDVTDVLKRFFRELEDPVFTHELHPQWKEAAKISSKPQRLERYKELIHR
LPRLNRKTLAALIGHLYRVQKCADLNQMTTKNLSLLFAPSLFQTDGKGEHEVKVMEDLID
NYVSIFNIDEDQVSQMELENSLITTWKDTQLSQAGDLIIEVYLEQKLPDCCVTLKVSPTM
TAEELTNQVLEMRNVATSLDIWLTFEVLENGELERPLHPKEKVLEQALQWCKLPEPSSAY
LLVRKVPISEASCLFTGAKRETPKCGLLKCREEPPKLLGSKFQERYFVIRDRQLLLLKEK
RSAKPEREWPLDAAKVYMGIKKKLKPPAQWGFTLSLDKQQLYLVCSGQAELWDWTTSILK
AQHDDLRPVIMRRRSSSDLAKQKFGTMPLVPLHGDSTDATMLSANQTLLRLHTRRTLSMF
FPMKVHQDSLEEEQQENEADAEPVYEEVGNFSELAALELERGLLSAVPPVDRSKKPTPSP
EHPPAPALRSSLPARGQEPVAMLESSPGTESSVSRKRSMQLSASINDKLIQELSSIILRK
NEGQPPATGPGQPPSSRVSSAQRLLPSPGPLAQDRGTRVPPLSLPAR
Download sequence
Identical sequences U3IEF1
ENSAPLP00000005623

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]