SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for U3IFA0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  U3IFA0
Domain Number 1 Region: 20-194
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 9.81e-40
Family BCR-homology GTPase activation domain (BH-domain) 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) U3IFA0
Sequence length 983
Comment (tr|U3IFA0|U3IFA0_ANAPL) Uncharacterized protein {ECO:0000313|Ensembl:ENSAPLP00000005922} KW=Complete proteome; Reference proteome OX=8839 OS=Anas platyrhynchos (Mallard) (Anas boschas). GN= OC=Anatinae; Anas.
Sequence
GRIFGVSFHVLPQSLVPGYGYIPSFLVDACEYLEEHIHTEGLFRKSGSLVRIKALKSKLD
QGENCLSAALPCDVAGLLKQFFRELPEPILPPHLQEGLFKAQQLGNEKKTATMLLSCLMT
DGTIEALRFFFKFLRNVSLRSNENRMDSSNLAVIFAPNLLHVNESEKMSTTTEKKIRLQA
AVVQTFIDHAEEIANSGQVPEFILEKIPAMLGVDAFQSTPSLRGHEDSENESPSECKRRK
HRSVGDIVSGALNKFKSNRTPSTTPQQDRSVLSSVTPVVLTPSTKRKLPADCSQGLSSKK
RRSFKPNFAFELLPSSIFNSSLTPASVHFEASPSVSLESSQTSLSPSTGGENHLSSTGNR
RSKRLANKKLYRAEPGKTGCFSPKISRKEMVRRSLRLKFGLGKSNRDNIVSGCAVGNRSE
NIGRRLASQQGLESTDECAKRDVLFSPYISEKVCRKGSKSVSKSEENLLTPKCNDKVVYR
MSWNSPTVTDSQEINCNEGILPGHTETGNSSSEPAFIFGKPPVVPDEHRPTAVDKQDNRL
KLCEEESNLTAETLLKVKQAFSESGSNLQSLIVDTKSSFTNVPGETLHETLCLTGLSPEK
ELAAELSGSLATADSRELFHQRNQSYAIDKQQSNKDAGKILEKRSFKTSIEIELQVQKPD
VKNVIEQLPVPQVQAREDESSVQNSPAKNGINKLDSFERKEEIELTHSQTSENHVLKCCN
LEENTAELSGSGQLPALQLPKSGCEVGNQYSQAENPDKTSTKTSSVSDHGKVSDHIQWFN
KLSLNDSSSASKTKPPLKFQRTPVRQSVRRINSLLEANRRSVSSQMVRGNDVGSPLVKSL
SCDSALSYCAEKLSKNSTAFSLRSESTYDQASASHSQLDFTSKSCHRCLNPSDKPDLSVR
TTGIYEQKETVLPSKSVLEDLTNHETVKSSLKVNADVNVPGFAPEKTTVARSAPGKEKLR
YRGSPKNPISKVKLLPTAKPVDL
Download sequence
Identical sequences U3IFA0
ENSAPLP00000005922

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]