SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for U3IGC6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  U3IGC6
Domain Number - Region: 422-496
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0734
Family PCI domain (PINT motif) 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) U3IGC6
Sequence length 1347
Comment (tr|U3IGC6|U3IGC6_ANAPL) eIF-3-theta {ECO:0000256|HAMAP-Rule:MF_03000} KW=Complete proteome; Reference proteome OX=8839 OS=Anas platyrhynchos (Mallard) (Anas boschas). GN=EIF3S10 OC=Anatinae; Anas.
Sequence
LPKYFVGAEHAVILLSEFLEVGKKQPALDVLYDVMKSKKHRTWQKIHEPIMLKYLELCVD
LRKSHLAKEGLYQYKNICQQVNIKSLEDVVRAYLKLAEEKTEAAKEESQQMVLDIEDLDN
IQTPESVLLSAVSGEDTQDRTDRLLLTPWVKFLWESYRQCLDLLRNNSRVERLYHDIAQQ
AFKFCLQYTRKAEFRKLCDNLRMHLGQIQRHHNQSTAINLNNPDSQSMHLETRLVQLDSA
ISMELWQEAFKAVEDIHGLFALSKKPPKPQLMANYYHKVSTVFWKSGNALFHASTLHRLY
HLSREMRKNLTQEEMQRMSTRVLLATLSIPITPERTDIARLLDMDGIIVEKQRRLATLLG
LQAPPTRGSLINDMVRFNVVQYVVPEVKELYNWLEVDFHPLKLCSRVSKVLNWVKDQAEK
EPELQLYVPHLQNNTILRLLQQVAQIYQSIEFSRLATLVPFVDAFQLERCIVDAARHCDL
QVRLDHTTRTLSFGSDLNYCTREDAPLGPQLQSMPSEQIRNQLTAMSSALAKALAVIKPP
HLLQEKEEQHQLAVTAFLKNSRKEHQRILARRQTIEERKERLESLNIQREKEELEQREAE
LQKVRKAEEERLRQEAKEREKERILQEHEQIKKKTVRERLEQIKKTELGAKAFKDIDIED
LEELDPDFIMAKQVEQLEKEKKELQERLKNQEKKIDYFERAKRLEEIPLIKTAYEEQRVR
DMELWEQQEEERITTLQLEREKALEHKNRLSRMLEDRDLFEARLKASRRTVYEDKLKQFQ
ERLAEERRNRLEERKKQRKEERRITYYREKEEEEQRLREEQLLKEREEKERIEREKREQE
QREYQERVKKLEELEKKKRQREMEIEERERRREEERRGLDDPFSRKESRWGDRGESESSW
RRGGETESEWRRAPVERDWRRGEARDDDRPFRRGDDLPRRGDDLPRRGDDLPRRGAAEEK
DRPSVGGAEDRPPRREGDEERPPRREGDEDRPPRRGLDEDRPPRRALDDDRXRRAADDDR
GPRRGMDDDRPPRRALDDDRPPRRGLDDDRPPRRALDDDRPPRRGLDDDRGRTQPPRRGL
DDDRGSWRAADDDRGPRRGLDDDRGPRRGLDDDRGPWRSTDDDRLSRRDDDRGPWRSSED
SRPGPWRPFGKPGGWREREKAREDSWGPPRDSRPPGDREWDRDKDRDENEKDREFDRERD
FDRDDRFRRPRDDAGWRRGPAEENSSWRDSSRREEWDRGGRDMRDRRADDRDLPPRRGPP
LRSDREEPSSWRRADDRREERGEEREPVRRSAPAPAAAPAAASPAASKDRERDGEKEKGS
WKTEKEREPVRRTKNETDEEGWTTVRR
Download sequence
Identical sequences U3IGC6
ENSAPLP00000006298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]