SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for U3IGP1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  U3IGP1
Domain Number 1 Region: 289-381
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.8e-30
Family Regulator of G-protein signaling, RGS 0.0000178
Further Details:      
 
Domain Number 2 Region: 19-106
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.25e-23
Family DEP domain 0.0059
Further Details:      
 
Weak hits

Sequence:  U3IGP1
Domain Number - Region: 207-242
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 0.0012
Family Transducin (heterotrimeric G protein), gamma chain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) U3IGP1
Sequence length 409
Comment (tr|U3IGP1|U3IGP1_ANAPL) Regulator of G protein signaling 11 {ECO:0000313|Ensembl:ENSAPLP00000006413} KW=Complete proteome; Reference proteome OX=8839 OS=Anas platyrhynchos (Mallard) (Anas boschas). GN=RGS11 OC=Anatinae; Anas.
Sequence
CLPAACPAPGCPRPMLAGQMERMIVSMQDPDMGIKMRNQRLLITVIPHAMTGNDIVEWLI
QKYGISEEAESLHLGNLIVKHGYIYPLKDPRSLTLRADESPYRFQVRALLRAXAAPGAVV
PMLRAPGPGESRAQDNYNLLHKRINHTWDFVVMQAREQLRAAKQRRKGDRIVXQPQPQAV
WGRPGPPLPGFLFSSPPRPSPGSVRLLQAKNMDYYRRAIEYCRKAMARTRVKSSICLEGA
VAVAEPRAPRSPRTCXLSSSRRSSVVSGPVRTPPRTCCPPHTSCPPPGXNLSFWEACEEL
RYGEQSRIAEIVDSIYQQFLAPGATRWVNIDSKTMERTLEGIKTPHRYVMDDAQMHIYML
MKKDSYPRFLKSELYRNLLAEAVIPPETKKRVFPFMRKQRHSSPSPALL
Download sequence
Identical sequences U3IGP1
ENSAPLP00000006413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]