SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for U3IKN2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  U3IKN2
Domain Number 1 Region: 202-321
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2e-43
Family ets domain 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) U3IKN2
Sequence length 625
Comment (tr|U3IKN2|U3IKN2_ANAPL) E74 like ETS transcription factor 1 {ECO:0000313|Ensembl:ENSAPLP00000007804} KW=Complete proteome; Reference proteome OX=8839 OS=Anas platyrhynchos (Mallard) (Anas boschas). GN=ELF1 OC=Anatinae; Anas.
Sequence
MAAVVQQNELMFEFASNVMEDEQQLGDPSIFPAVIVEHVPSAELLHNYSGLTCVDEPSDM
ITESSLDVAEEQIIEDDDITLTVETSCHNGDETIETIEAAEALLNMDSPGPMLDEKRITT
MFGATEDEDMVAPITHVSVTLDGIPEVVEVQAPDPYAESPETPEYEQPKKKKGKKPKPTR
PESPTTTPNISLKKKNKDGKGNTIYLWEFLLALLQDKATCPKYIKWTQREKGIFKLVDSK
AVSRLWGKHKNKPDMNYETMGRALRYYYQRGILAKVEGQRLVYQFKEMPKDLVYIDDEDA
SPSTESSDSTLLSTPVASRNQSSRSRASANAGTKGGSTTVLKTGNSKPAKLKEPVEVVQQ
QTPGLTSEVLRTMQSTQPVHPTQLFRTVHVMQPLQSITEGQAAVSSNVADETLNPSVQNI
RTLQTPTQVPVVVSPGNQQLHTVTLQTVPLTTVIASTDPASSATPQKFILQAIPTSQPMT
VLKENVMLQSQKPVSPSSSIVLSPAQVQQVLTSSVQTICNGTVNMASSPSFTATTPVVTF
SPSSSQVVAHPSGTVITSVIKAPETKQIGVQGALKEEDSDKLDDTEQSEQRFQQQPFVMV
VSSSNGFPSNVQVKQEDEPLEPNSY
Download sequence
Identical sequences U3IKN2
ENSAPLP00000007804

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]