SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for U3IL54 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  U3IL54
Domain Number 1 Region: 5-265
Classification Level Classification E-value
Superfamily YWTD domain 5.62e-56
Family YWTD domain 0.00000202
Further Details:      
 
Domain Number 2 Region: 618-873
Classification Level Classification E-value
Superfamily YWTD domain 2.22e-55
Family YWTD domain 0.00000508
Further Details:      
 
Domain Number 3 Region: 316-546
Classification Level Classification E-value
Superfamily YWTD domain 1.22e-49
Family YWTD domain 0.00000227
Further Details:      
 
Domain Number 4 Region: 920-1179
Classification Level Classification E-value
Superfamily YWTD domain 6.8e-39
Family YWTD domain 0.0000568
Further Details:      
 
Domain Number 5 Region: 1310-1346
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000419
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 6 Region: 1272-1308
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000144
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 7 Region: 573-619
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000195
Family EGF-type module 0.013
Further Details:      
 
Domain Number 8 Region: 1231-1271
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000034
Family LDL receptor-like module 0.00092
Further Details:      
 
Domain Number 9 Region: 876-921
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000399
Family EGF-type module 0.039
Further Details:      
 
Domain Number 10 Region: 270-313
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000177
Family EGF-type module 0.011
Further Details:      
 
Domain Number 11 Region: 1189-1241
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000239
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) U3IL54
Sequence length 1590
Comment (tr|U3IL54|U3IL54_ANAPL) Low-density lipoprotein receptor-related protein {ECO:0000256|PIRNR:PIRNR036314} KW=Complete proteome; Reference proteome OX=8839 OS=Anas platyrhynchos (Mallard) (Anas boschas). GN=LRP5 OC=Anatinae; Anas.
Sequence
SVASPFLLFANRRDVRLVDAGGTKLESTVVVSGLEDAAAVDFQYSQGIVFWTDVSEEAIK
QTYINQTGNVVQNVIISGLVSPDGLACDWIGKKLYWTDSETNRIEVANLNGTSRKVLFWQ
DLDQPRAIALDPAHGYMYWTDWGETPRIERAGMDSSTRKIIVDSDIYWPNGLTIDLDEQK
LYWADAKLSFIHRANLDGSFRQKVVEGSLTHPFALTLSGDTLYWTDWQTRSIHACNKRTG
EKRREILSALYSPMDIQVLSPDRQPYFHTPCEENNGGCSHLCLLSPRDPFYSCACPTGVQ
LEDDGRTCKSGAEEVLLLARRTDLRRISLDMPDFTDIILQIDNIRHAIAIDYDPVEGYIY
WTDDDVRAIRRAYLDGSGAQTLVTSEINHPDGIAVDWVARNLYWTDTGTDRIEVTRLNGT
SRKILISENLDEPRAIVLNPVMGYMYWTDWGESPKIECAYLDGSERRVLVNTSLGWPNGL
ALDLEEDKLYWGDAKTDKIEVINVDGTMRKTLLEDKLPHIFGFTLLGDYIYWTDWQRRSI
ERVHKIRASRDIIIDQLPDLMGLKATSVAKVFEGTNPCAENNGGCSHLCFFTPQETRCAC
PIGLELLSDMKTCIIPEAFLVFTSRAAIHRISLETNNNDVAIPLTGVKEASALDFDVSDN
RIYWTDVSLKTISRAFMNGSSVEHVIEFGLDYPEGMAVDWMGKNLYWADTGTNRIEVARL
DGQYRQVLVWKDLDNPRSLALDPTKGYMYWTEWGGKPRIVRAYMDGTNSITLVDKVGRAN
DLTIDYADQRLYWTDLDTSMIESSNMLGQEREIIADDLPHPFGLTQYSDYIYWTDWNLHS
IERADKTSGKNRTLIQGHLDFVMDILVFHSSRQDGLNDCVQNNGHCGHLCLAIPNGFRCG
CAAHYTLDPNSRNCSSPTSFLLFSQKSAISRMIPDDQQSPDIILPMHGLRNVKAIDYDPL
DKLIYWVDGRQNIIKRAKDDGTQPFTVMSSPNQSQNPEKQPHDLSIDIYSHTLYWTCEAT
NSVNVHRLNGESIGMVLRGDHDKPRAIVVNAERGYMYFTNMQERAPKIERAALDGTEREV
LFTTGLIRPVALVIDNKLGKLFWVDADLKRIESCDLSGANRVTLEDSNILQPMGLTVLGN
HLYWIDRQQQMIERVEKTNGYKRTRIQGRIAHLTGIHAVEELDMEEFSAHPCSRDNGGCS
HICIAKGDGTPRCSCPEHLVLLQNLLTCGEPPTCSPDQFTCATGEIDCIPMAWRCDGFPE
CDDQSDEDSCPICSASQFQCEKGQCIDAHLRCNGEIDCQDKSDEVDCDTLCLPNQFRCAS
GQCILLKQQCDSFPDCIDGSDELICEKTKPASDEPQPHSSAIGPVIGIILSLFVMGGMYF
VCQRVVCQRYAGPNSPFPHEYVSGTPHVPLNFIAPGSSQHGTFTGISCGKSMISSMSLMG
GSSGAPLYDRNHVTGASSSSSSSTKATFYPQILNPPPSPATDRSLYNAEMFYSSNIPSTT
RSYRPYLIRGIAPPTTPCSTDVCDSDYTTSRWKANKYYIDLNSDSDPYPPPPTPRSQYMS
AEESCPPSPATERSYFHLYPPPPSPCTDSS
Download sequence
Identical sequences U3IL54
ENSAPLP00000007976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]