SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for U3ILA0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  U3ILA0
Domain Number 1 Region: 1-208,280-308
Classification Level Classification E-value
Superfamily Creatinase/aminopeptidase 1.28e-51
Family Creatinase/aminopeptidase 0.00031
Further Details:      
 
Domain Number 2 Region: 205-281
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000000571
Family Methionine aminopeptidase, insert domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) U3ILA0
Sequence length 364
Comment (tr|U3ILA0|U3ILA0_ANAPL) Uncharacterized protein {ECO:0000313|Ensembl:ENSAPLP00000008022} KW=Complete proteome; Reference proteome OX=8839 OS=Anas platyrhynchos (Mallard) (Anas boschas). GN=PA2G4 OC=Anatinae; Anas.
Sequence
VLRAVVEAASSGASVLCLCEKGDAMIMEETGKIFKKEKEMKKGIAFPTSISVNNCVCHFS
PLKSDQDYILKDGDLVKIDLGVHVDGFIANVAHSFVIDASKENPVSGRKADVIKAAHLCA
EAALRLVKPGNQNTQVTDTWNKIAHSFHCTPIEGMLSHQLKQHVIDGEKTIIQNPTDQQK
KDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQRTTIYKRDPSKQYGLKMKTSRAFFSEVE
RRFDTMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLYEKEGEFVAQFKFTVLLMPNGP
MRITSGPFEPELYKSEFEVQDGELKALLQSSASRKTQKKKKKKASKNAENATTGETAEEN
EAGD
Download sequence
Identical sequences U3ILA0
ENSAPLP00000008022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]