SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for U3IM37 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  U3IM37
Domain Number 1 Region: 880-1182
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 4.81e-92
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000107
Further Details:      
 
Domain Number 2 Region: 216-360
Classification Level Classification E-value
Superfamily PH domain-like 1.05e-34
Family Third domain of FERM 0.0014
Further Details:      
 
Domain Number 3 Region: 109-214
Classification Level Classification E-value
Superfamily Second domain of FERM 2.49e-27
Family Second domain of FERM 0.00036
Further Details:      
 
Domain Number 4 Region: 21-106
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.2e-18
Family First domain of FERM 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) U3IM37
Sequence length 1186
Comment (tr|U3IM37|U3IM37_ANAPL) Tyrosine-protein phosphatase non-receptor type {ECO:0000256|PIRNR:PIRNR000934} KW=Complete proteome; Reference proteome OX=8839 OS=Anas platyrhynchos (Mallard) (Anas boschas). GN=PTPN21 OC=Anatinae; Anas.
Sequence
MPLPFGLKLKRTRRYTVSSKSCLVARIQLLNNEFVEFTLSVESTGQESLEAVAQRLELRE
ITYFSLWYYNKQNQRRWVDLDKPLKKQLDKYALEPTVYFGVVFYVPTVSQLQQEITSRYQ
YYLQLKKDILEGNIPCTLEQAIHLAGLAVQADFGDYDQYESQEFLQRFALFPVGWLQEEK
ILEEATQKVALLHQKYRGLTPPDAEMLYMQEVERMDGYGEETYPAKDSQGSDIFIGACLD
GIFVKHKNGRPPVVFRWHDIANMSHNKSFFALELANKEETIQFQTEDMETAKYVWRMCVA
RHKFYRLNKCSLQTQPVTVNPVRRRSSSRMSMPKPQAYMMPPPPQLHYNGHYTEPYASSQ
DNLFVSNQNGYYCHSQTSLDRAPHDYGGRIRNGSVYSAHSTNSLNNPQHYLQPSPMSSNP
SITGSDVLRTDYVPSHRHSALIPPSYRPTPDYETVMRQLKRGMVHTDRQSHSMRNLNISN
TYAYSRPDALVYSQPEIREHAHFTSPQSNHYPFNLNYSFHSQSPYPYPAEKRPVVGAVSV
PELTNVQLQAQDYPAPNIMKTQVYRPPPPYPYPRPANSTPDLSRHIYISSSNPDLITRRV
HHSVQTFQEDSLPVAHSLQEVSEPLTSARHAQLQKRNSIEIAGLTPSFEGIRIKERTMSA
SAADVALPRAISEGSQPNILMERTKQKENEQDEGVSCDHKKTLSDATMLIHSSEEEEEFE
EENKASTSLSPLPEDRTQLSSIMGGYSHDPVLNYPYSSVASSAGPLHILEPKLHITETEK
RIKDMSPVHLLVESQVQRRGEGLLMPSMSESDLTMSGRYRVRKDSIKKRPVSDLLSGKKN
IVEGLPPLGGMKKNKTDAKKIGPLKLAALNGLTLTRMPLPDEGKEESTRATNDERCKVLE
QRLEQGMVFTEYERIQKKRLIDGECSIARLPENAERNRFQDVLPYDDTRVELVPTKENNT
GYINASHIKISVGGMEWDYIATQGPLQNTCQDFWQMIWEQGIAIIAMVTAEEESGREKSF
RYWPRLGSRHNTVTYGRFKITTRFRTDSGCYATTGLKIKHLLTGQERTVWHLQYTDWPEH
GCPEDLKGFLSYLEEIQSVRRHTNSTADPKNSNPPVLVHCSAGVGRTGVVILSEIMIACL
EHNEMLDIPRVLDMLRQQRMMMVQTLSQYTFVYGVLIQFLKSSRLI
Download sequence
Identical sequences U3IM37
ENSAPLP00000008309

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]