SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for U3INM6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  U3INM6
Domain Number 1 Region: 564-634
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.26e-16
Family Rad21/Rec8-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) U3INM6
Sequence length 637
Comment (tr|U3INM6|U3INM6_ANAPL) RAD21 cohesin complex component {ECO:0000313|Ensembl:ENSAPLP00000008849} KW=Complete proteome; Reference proteome OX=8839 OS=Anas platyrhynchos (Mallard) (Anas boschas). GN=RAD21 OC=Anatinae; Anas.
Sequence
MFYAHFVLSKRGPLAKIWLAAHWDKKLTKAHVFECNLESSVESIISPKVKMALRTSGHLL
LGVVRIYHRKAKYLLADCNEAFIKIKMAFRPGVVDLPEENREAAYNAITLPEEFHDFDQP
LPDLDDIDVAQQFSLNQSRVEEITMREEVGNISILQDNDFGDFGMDDREMMREGSAFEDD
MLVSTSASNLLLEPEQSTSHLNEKANHLEYEDQYKDDNFGEGNDGGILDDKLLSNNDGGI
FDDPPALSESGVMMPEQPPHDDMDDDDNVSMGGPDSPDSVDPVEPLPTMTDQTTLVPNEE
EAFALEPIDITVKETKAKRKRKLIVDSVKELDSKTIRAQLSDYSDIVTTLDLAPPTKKLM
MWKETGGVEKLFSLPAQPLWNNRLLKLFTRCLTPLVPEDLRKRRKGGEADNLDEFLKDFE
NPEVPREENFLSRNRRPEICFDPNIDEPILEEPSRLQESMMEGSRTNLDESVMPPPPPQT
GVKRKLQQVEPEPVIPHPPSQQLEIPPVEMPPEEPQNICQLIPELELLPLQNKSIDTIML
NTNSPREEDGTGGDQDQEERRWNKRTQQMLHGLQRALAKTGAESISLLELCRNTNRKQAA
AKFYSFLVLKKQQAIELTQEEPYSDIIATPGPRFHII
Download sequence
Identical sequences U3INM6
ENSAPLP00000008849

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]