SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for U3IP61 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  U3IP61
Domain Number 1 Region: 99-213
Classification Level Classification E-value
Superfamily ARID-like 6.93e-36
Family ARID domain 0.00000203
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) U3IP61
Sequence length 434
Comment (tr|U3IP61|U3IP61_ANAPL) AT-rich interaction domain 3B {ECO:0000313|Ensembl:ENSAPLP00000009034} KW=Complete proteome; Reference proteome OX=8839 OS=Anas platyrhynchos (Mallard) (Anas boschas). GN=ARID3B OC=Anatinae; Anas.
Sequence
DGADVTGKEPCSALKYFHAPKAAQHNQRVASTSNSPPAAGHPRGQQGREEQGKDTAKQPY
SGSPAARWRLDEQLKQNGSVTWSDEGDGCRGREISRDFAKLYELDSDPERKEFLDDLFIF
MQKRGTPINRIPIMAKQILDLYMLYKLVTEKGGLVEIINKKIWREITKGLNLPTSITSAA
FTLRTQYMKYLYAYECEKKSLSSPAELQAAIDGNRREGRRPSYSSSLFSYSTATGPPSLL
SPPKIRFPIIGVAPGSGTSNPRVSPAAAVRKGDGVPLTVSMPNRIAVPVTLASQQATVAA
RTATLLRERLESGEPPEKKVSRMTEEEQRLVQQALQRNLFSMARQIPMKIKINGKEDKPD
SAAAAALNLSPNGIGSINMSVEINGTIYAGVLFAQKPVVHLIAGSSTQSSSHCSASPTSS
RGTPGAEPSTSWSL
Download sequence
Identical sequences U3IP61
ENSAPLP00000009034

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]