SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for U3IPA7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  U3IPA7
Domain Number 1 Region: 316-424
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 6.8e-46
Family ets domain 0.00000201
Further Details:      
 
Domain Number 2 Region: 164-256
Classification Level Classification E-value
Superfamily SAM/Pointed domain 2.37e-28
Family Pointed domain 0.0000237
Further Details:      
 
Domain Number 3 Region: 43-103
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000012
Family Ubiquitin-related 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) U3IPA7
Sequence length 455
Comment (tr|U3IPA7|U3IPA7_ANAPL) GA binding protein transcription factor alpha subunit {ECO:0000313|Ensembl:ENSAPLP00000009080} KW=Complete proteome; Reference proteome OX=8839 OS=Anas platyrhynchos (Mallard) (Anas boschas). GN=GABPA OC=Anatinae; Anas.
Sequence
QDVLAMTKRDAEELIEIEIDGTEKQECTEESIVEQTYTTAEFVSQAIDINEPIGNLKKLL
EPRLQCSLDAHEICLQDIQLDPDRSLFDQGVKTDGTVQLSVQVISRQGIEPKLNILEIVK
PVETVEVVIDPDAHHAEAEAHLVEEAQVITLDGTKHITTISDETSEQVTRWAAALEGYRK
EQERLGIPYDPVQWSTDQVLHWVVWVMKEFSMSDIDLNALSIPGRELCSLTQEDFFQRVP
RGEILWSHLELLRKYVLASQEHSGEIATVTIDQPVQIIPASVQPATPTTIKVINSSAKAA
KVQRAPRISGEDRSSPGNRTGNNGQIQLWQFLLELLTDKDARDCISWVGDEGEFKLNQPE
LVAQKWGQRKNKPTMNYEKLSRALRYYYDGDMICKVQGKRFVYKFVCDLKTLIGYSAAEL
NRLVTECEQKKLAKMQLHGIAQPVTAVALATASLQ
Download sequence
Identical sequences U3IPA7
ENSAPLP00000009080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]