SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for U3IQU6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  U3IQU6
Domain Number 1 Region: 111-184
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 5.17e-26
Family P4 origin-binding domain-like 0.0000202
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) U3IQU6
Sequence length 211
Comment (tr|U3IQU6|U3IQU6_ANAPL) Uncharacterized protein {ECO:0000313|Ensembl:ENSAPLP00000009619} KW=Complete proteome; Reference proteome OX=8839 OS=Anas platyrhynchos (Mallard) (Anas boschas). GN=LOC101797854 OC=Anatinae; Anas.
Sequence
RTTYPYTETQMYSQNTGGNYFDTQGSSAQVTTVVSSHSMVGTGGIQMGVTGGQLISSSGG
TYLIGNSMENSGHSVTHTMRTSPATIEMAIETLQKSDGLSTHRSSLLNSHLQWLLDNYET
AEGVSLPRSTLYNHYLRHCQEHKLDPVNAASFGKLIRSIFMGLRTRRLGTRGNSKYHYYG
IRVKPDSPLNRLQEDMQYMAMRQQPMQQKHR
Download sequence
Identical sequences U3IQU6
ENSAPLP00000009619

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]