SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for U3ISV8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  U3ISV8
Domain Number 1 Region: 12-116
Classification Level Classification E-value
Superfamily ARID-like 5.23e-34
Family ARID domain 0.00034
Further Details:      
 
Domain Number 2 Region: 523-600
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000000106
Family P4 origin-binding domain-like 0.0091
Further Details:      
 
Domain Number 3 Region: 280-455
Classification Level Classification E-value
Superfamily ARM repeat 0.0000057
Family Clathrin adaptor core protein 0.025
Further Details:      
 
Weak hits

Sequence:  U3ISV8
Domain Number - Region: 1625-1650
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0724
Family Classic zinc finger, C2H2 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) U3ISV8
Sequence length 1828
Comment (tr|U3ISV8|U3ISV8_ANAPL) AT-rich interaction domain 2 {ECO:0000313|Ensembl:ENSAPLP00000010331} KW=Complete proteome; Reference proteome OX=8839 OS=Anas platyrhynchos (Mallard) (Anas boschas). GN=ARID2 OC=Anatinae; Anas.
Sequence
MANSTGKNHADQRRKGLAFLDELRQFHHSRGSPFKKIPVVGGKELDLHALYTRVTTLGGF
GKVSEKNQWGEIVEEFNFPRSCSNAAFALKQYYLRYLEKYEKVHHFGEEDDEVQPGNPKP
QLPIGAIPSSYNYQQHSVSDYLRQSYGLSMDFNSPNDYNKLVLSLLSGLPNEVDFAINVC
TLLSNESKHVMQLEKDPKIITLLLANAGVFDDTLGSFSAVFGEEWKEKTDRDFVKFWKDI
VEDIEVRDLISDRSKSQEIPSEDWIWESLFHPPRKLGINDIEGQRVLQIAVILRNLSFEE
GNVKLLAANRTCLRFLLLSAHSHFISLRQLGLDTLGNIAAELLLDPVDFKTTHLMFHTVT
KCLMSRDRFLKMRGMEILANLCKAEDNGVLICEYVDQESYKEIICHLTLPDVLLVISALE
VLYMLTEMGEVACTKISKVEKSIDTLVCLVSMDIQMFGPDALTAVKLIEHQCVNQQGVPD
VRPPVMDHGSSQAHAAGVPASRAAPHVAPPPGIVEIDSEKFACQWLNAHFEVYLDCSVSR
AEMYSEYLSTCSKLARGGILTSTGFYKCLRTVFPNHTVKRVEDPNNNGQAHIHVVGVKRR
AIPLPIQMYYQQQPTSSTPVVRVDSIPDVSSSPSPAVGIPHGPQSVGNHYQRTPINQSST
LTATQMSFPIQGVHTVAQTVSRIPQNPVHAQQQNATMTVIQNKGPIPCEVVKATVIQSSV
PQSGVPVTIAVGGAQASNQNHSSTGPQPSVAVVGSQTLLHHQPVIQQQSPLHAVVPGQIP
SGTPVTVIQQAVPQGHIFGRVQNIPACSSAVSQGQQLITTSSQPGQTSSQPSSTGNQQQD
TVIIAPQQYVTTSASNIVSATTVQNFQVAAGQVVTIAGVQNPPTSRVGFQNIAPKPSQQG
PPNVQQPMQSQQQPQPPPSQQSVVIVSQPAQQGQTYAPAIHQIVLANPASIPAGQTVQLT
GQPSITPSSSPSPGPVTNNQVPTVMSSSCTTSQSQGPPPTVSQMLSVKRQQQQQHSPASS
QQQVQQPIQMQVQSQQANAGVGQPNSGESSLIKQLLLPKRGPSTPGGKLILPAPQIPPPN
NARAPSPQVVYQMANNQAPGYGVQGQSSAQQLLVGQQNVQLVQGAIPPQGAVQTVPISNL
QILPGQLISNSPATIFQGTTGNQVTITVVPNTSFATATVSQGNATQIIAPAGIAVSGTQT
GVGLQVQTLPATQAPSAGQSPCTAAPPFKGDKIICQKEEEAKEATGLHIHERKIEVMENP
SCRRGAANTSNGDAKENEMQVGSLLNGRKYSDSSLPPSNSGKTQNEANQCSQVSNGPSLE
MGENGAPGKQNFEQMDTQEIKSDLKKPLVNGICDFDKGDGSHLSKNIPNHKTSNHVGNGE
ISSVEQQGNLDATQQDTAKGDQGERISNGPVLTLSSSPVVSGTQEAAKLLTQQLSGTNTD
LPNGPLASSLNSDVPQQRPSVVVSPQSTASVIQGHQIIAVPHSGPRVSQSTLSSEVRSTN
GTAECKTVKRPAEDNDRETVPGIPNKVGVRIVTISDPNNAGCSATMVAVPAGADPSTVAK
VAIESAVQQKQQHPTTYIQSMVTQSTPATSIPTVQVQGQQINLQPPSYTAASQHAEQMKK
PGQNFMCLWQSCKKWFQTPSQVFYHAATEHGGKDVYPGQCLWEGCEPFQRQRFSFITHLQ
DKHCSRDALLAGLKQDELGQAGNQKPPNKPPAVGGTPAAPRAQKAIVNHPSAALMALRRG
SRNLVFRDFTDEKEGPITKHIRLTAALILKNIGKYSECGRRLLKRHENHLSVLAISNMEA
SSTLAKCLYELNFTVQSKEHEKDSEMLQ
Download sequence
Identical sequences U3ISV8
ENSAPLP00000010331

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]